KEGG   Homo sapiens (human): 8317Help
Entry
8317              CDS       T01001                                 

Gene name
CDC7, CDC7L1, HsCDC7, Hsk1, huCDC7
Definition
cell division cycle 7 (EC:2.7.11.1)
Orthology
K02214  
cell division control protein 7 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8317 (CDC7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8317 (CDC7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  CDC7 family
   8317 (CDC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p22
AA seq 574 aa AA seqDB search
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgtctttggggattcagatggatgagccaatggctttttctccccagcgtgac
cggtttcaggctgaaggctctttaaaaaaaaacgagcagaattttaaacttgcaggtgtt
aaaaaagatattgagaagctttatgaagctgtaccacagcttagtaatgtgtttaagatt
gaggacaaaattggagaaggcactttcagctctgtttatttggccacagcacagttacaa
gtaggacctgaagagaaaattgctctaaaacacttgattccaacaagtcatcctataaga
attgcagctgaacttcagtgcctaacagtggctggggggcaagataatgtcatgggagtt
aaatactgctttaggaagaatgatcatgtagttattgctatgccatatctggagcatgag
tcgtttttggacattctgaattctctttcctttcaagaagtacgggaatatatgcttaat
ctgttcaaagctttgaaacgcattcatcagtttggtattgttcaccgtgatgttaagccc
agcaattttttatataataggcgcctgaaaaagtatgccttggtagactttggtttggcc
caaggaacccatgatacgaaaatagagcttcttaaatttgtccagtctgaagctcagcag
gaaaggtgttcacaaaacaaatcccacataatcacaggaaacaagattccactgagtggc
ccagtacctaaggagctggatcagcagtccaccacaaaagcttctgttaaaagaccctac
acaaatgcacaaattcagattaaacaaggaaaagacggaaaggagggatctgtaggcctt
tctgtccagcgctctgtttttggagaaagaaatttcaatatacacagctccatttcacat
gagagccctgcagtgaaactcatgaagcagtcaaagactgtggatgtactgtctagaaag
ttagcaacaaaaaagaaggctatttctacaaaagttatgaatagtgctgtgatgaggaaa
actgccagttcttgcccagctagcctgacctgtgactgctatgcaacagataaagtttgt
agtatttgcctttcaaggcgtcagcaggttgcccctagggcaggtacaccaggattcaga
gcaccagaggtcttgacaaagtgccccaatcaaactacagcaattgacatgtggtctgca
ggtgtcatatttctttctttgcttagtggacgatatccattttataaagcaagtgatgat
ttaactgctttggcccaaattatgacaattaggggatccagagaaactatccaagctgct
aaaacttttgggaaatcaatattatgtagcaaagaagttccagcacaagacttgagaaaa
ctctgtgagagactcaggggtatggattctagcactcccaagttaacaagtgatatacaa
gggcatgcttctcatcaaccagctatttcagagaagactgaccataaagcttcttgcctc
gttcaaacacctccaggacaatactcagggaattcatttaaaaagggggatagtaatagc
tgtgagcattgttttgatgagtataataccaatttagaaggctggaatgaggtacctgat
gaagcttatgacctgcttgataaacttctagatctaaatccagcttcaagaataacagca
gaagaagctttgttgcatccattttttaaagatatgagcttgtga

DBGET integrated database retrieval system