KEGG   Homo sapiens (human): 8318Help
Entry
8318              CDS       T01001                                 

Gene name
CDC45, CDC45L, CDC45L2, PORC-PI-1
Definition
cell division cycle 45
Orthology
K06628  
cell division control protein 45
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8318 (CDC45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 598 aa AA seqDB search
MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELET
AFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIK
QDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEAR
SGSGSEPVAAALEKSSRLFAGPMSDRTAPRSPRRDILFDYEQYEYHGTSSAMVMFELAWM
LSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHRNEDEENTLSVDCT
RISFEYDLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQK
FQAMDISLKENLREMIEESANKFGMKDMRVQTFSIHFGFKHKFLASDVVFATMSLMESPE
KDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYC
SLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVG
IPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgtccgatttccgcaaagagttctacgaggtggtccagagccagagggtcctt
ctcttcgtggcctcggacgtggatgctctgtgtgcgtgcaagatccttcaggccttgttc
cagtgtgaccacgtgcaatatacgctggttccagtttctgggtggcaagaacttgaaact
gcatttcttgagcataaagaacagtttcattattttattctcataaactgtggagctaat
gtagacctattggatattcttcaacctgatgaagacactatattctttgtgtgtgacacc
cataggccagtcaatgtcgtcaatgtatacaacgatacccagatcaaattactcattaaa
caagatgatgaccttgaagttcccgcctatgaagacatcttcagggatgaagaggaggat
gaagagcattcaggaaatgacagtgatgggtcagagccttctgagaagcgcacacggtta
gaagaggagatagtggagcaaaccatgcggaggaggcagcggcgagagtgggaggcccgg
agtggctctgggagtgaacctgtggccgctgcattggagaagagctccaggttgttcgcc
ggtcccatgagtgacaggacagccccaaggtctcccagaagagacatcctctttgactac
gagcagtatgaatatcatgggacatcgtcagccatggtgatgtttgagctggcttggatg
ctgtccaaggacctgaatgacatgctgtggtgggccatcgttggactaacagaccagtgg
gtgcaagacaagatcactcaaatgaaatacgtgactgatgttggtgtcctgcagcgccac
gtttcccgccacaaccaccggaacgaggatgaggagaacacactctccgtggactgcaca
cggatctcctttgagtatgacctccgcctggtgctctaccagcactggtccctccatgac
agcctgtgcaacaccagctataccgcagccaggttcaagctgtggtctgtgcatggacag
aagcggctccaggagttccttgcagacatgggtcttcccctgaagcaggtgaagcagaag
ttccaggccatggacatctccttgaaggagaatttgcgggaaatgattgaagagtctgca
aataaatttgggatgaaggacatgcgcgtgcagactttcagcattcattttgggttcaag
cacaagtttctggccagcgacgtggtctttgccaccatgtctttgatggagagccccgag
aaggatggctcagggacagatcacttcatccaggctctggacagcctctccaggagtaac
ctggacaagctgtaccatggcctggaactcgccaagaagcagctgcgagccacccagcag
accattgccagctgcctttgcaccaacctcgtcatctcccaggggcctttcctgtactgc
tctctcatggagggcactccagatgtcatgctgttctctaggccggcatccctaagcctg
ctcagcaaacacctgctcaagtcctttgtgtgttcgacaaagaaccggcgctgcaaactg
ctgcccctggtgatggctgcccccctgagcatggagcatggcacagtgaccgtggtgggc
atccccccagagaccgacagctcggacaggaagaacttttttgggagggcgtttgagaag
gcagcggaaagcaccagctcccggatgctgcacaaccattttgacctctcagtaattgag
ctgaaagctgaggatcggagcaagtttctggacgcacttatttccctcctgtcctag

DBGET integrated database retrieval system