KEGG   Homo sapiens (human): 8321Help
Entry
8321              CDS       T01001                                 

Gene name
FZD1
Definition
frizzled class receptor 1
Orthology
K02432  
frizzled 1/7
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8321 (FZD1)
   04390 Hippo signaling pathway
    8321 (FZD1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    8321 (FZD1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    8321 (FZD1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8321 (FZD1)
   05205 Proteoglycans in cancer
    8321 (FZD1)
   05217 Basal cell carcinoma
    8321 (FZD1)
  Infectious diseases
   05166 HTLV-I infection
    8321 (FZD1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    8321 (FZD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21
AA seq 647 aa AA seqDB search
MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSG
CYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVG
LNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVF
SVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggccgccggcggtggcgcgagctgggaa
ctttgtgccggggcgctctcggcccggctggcggaggagggcagcggggacgccggtggc
cgccgccgcccgccagttgacccccggcgattggcgcgccagctgctgctgctgctttgg
ctgctggaggctccgctgctgctgggggtccgggcccaggcggcgggccaggggccaggc
caggggcccgggccggggcagcaaccgccgccgccgcctcagcagcaacagagcgggcag
cagtacaacggcgagcggggcatctccgtcccggaccacggctattgccagcccatctcc
atcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctgggccac
acgaaccaggaggacgcgggcctggaggtgcaccagttctaccctctagtgaaagtgcag
tgttccgctgagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgcta
gagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgcgaggcg
ctcatgaacaagttcggcttccagtggccagacacgctcaagtgtgagaagttcccggtg
cacggcgccggcgagctgtgcgtgggccagaacacgtccgacaagggcaccccgacgccc
tcgctgcttccagagttctggaccagcaaccctcagcacggcggcggagggcaccgtggc
ggcttcccggggggcgccggcgcgtcggagcgaggcaagttctcctgcccgcgcgccctc
aaggtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgcaccttgt
gagccgaccaaggtgtatgggctcatgtacttcgggcccgaggagctgcgcttctcgcgc
acctggattggcatttggtcagtgctgtgctgcgcctccacgctcttcacggtgcttacg
tacctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcttgtccggc
tgttacacggccgtggccgtggcctacatcgccggcttcctcctggaagaccgagtggtg
tgtaatgacaagttcgccgaggacggggcacgcactgtggcgcagggcaccaagaaggag
ggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgg
gtgatcctgtcgctcacctggttcctggcggctggcatgaagtggggccacgaggccatc
gaagccaactcacagtattttcacctggccgcctgggctgtgccggccatcaagaccatc
accatcctggcgctgggccaggtggacggcgatgtgctgagcggagtgtgcttcgtgggg
cttaacaacgtggacgcgctgcgtggcttcgtgctggcgcccctcttcgtgtacctgttt
atcggcacgtcctttctgctggccggctttgtgtcgctcttccgcatccgcaccatcatg
aagcacgatggcaccaagaccgagaagctggagaagctcatggtgcgcattggcgtcttc
agcgtgctgtacactgtgccagccaccatcgtcatcgcctgctacttctacgagcaggcc
ttccgggaccagtgggaacgcagctgggtggcccagagctgcaagagctacgctatcccc
tgccctcacctccaggcgggcggaggcgccccgccgcacccgcccatgagcccggacttc
acggtcttcatgattaagtaccttatgacgctgatcgtgggcatcacgtcgggcttctgg
atctggtccggcaagaccctcaactcctggaggaagttctacacgaggctcaccaacagc
aaacaaggggagactacagtctga

DBGET integrated database retrieval system