KEGG   Homo sapiens (human): 8323Help
Entry
8323              CDS       T01001                                 

Gene name
FZD6, FZ-6, FZ6, HFZ6, NDNC10
Definition
frizzled class receptor 6
Orthology
K02376  
frizzled 6
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Disease
H01307  
Nonsyndromic congenital nail disorder (NDNC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8323 (FZD6)
   04390 Hippo signaling pathway
    8323 (FZD6)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    8323 (FZD6)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    8323 (FZD6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8323 (FZD6)
   05205 Proteoglycans in cancer
    8323 (FZD6)
   05217 Basal cell carcinoma
    8323 (FZD6)
  Infectious diseases
   05166 HTLV-I infection
    8323 (FZD6)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    8323 (FZD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q22.3-q23.1
AA seq 706 aa AA seqDB search
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEH
FLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREV
KADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITD
TGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtttacatttttgttgacgtgtatttttctacccctcctaagagggcacagt
ctcttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgacg
tttttccctaatctgatgggtcattatgaccagagtattgccgcggtggaaatggagcat
tttcttcctctcgcaaatctggaatgttcaccaaacattgaaactttcctctgcaaagca
tttgtaccaacctgcatagaacaaattcatgtggttccaccttgtcgtaaactttgtgag
aaagtatattctgattgcaaaaaattaattgacacttttgggatccgatggcctgaggag
cttgaatgtgacagattacaatactgtgatgagactgttcctgtaacttttgatccacac
acagaatttcttggtcctcagaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggatataagtttctgggaattgaccag
tgtgcgcctccatgccccaacatgtattttaaaagtgatgagctagagtttgcaaaaagt
tttattggaacagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttagaagattcagatacccagagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggatttttgctaggcgatagcacagcctgc
aataaggcagatgagaagctagaacttggtgacactgttgtcctaggctctcaaaataag
gcttgcaccgttttgttcatgcttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatc
gagcaaaaagcagtgtggtttcatgctgttgcatggggaacaccaggtttcctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggagtttgctttgttggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctctctcttcttttagctggcattatttccttaaatcatgttcgacaagtcata
caacatgatggccggaaccaagaaaaactaaagaaatttatgattcgaattggagtcttc
agcggcttgtatcttgtgccattagtgacacttctcggatgttacgtctatgagcaagtg
aacaggattacctgggagataacttgggtctctgatcattgtcgtcagtaccatatccca
tgtccttatcaggcaaaagcaaaagctcgaccagaattggctttatttatgataaaatac
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggaatcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactataaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaattactagccatgattac
ctaggacaagaaactttgacagaaatccaaacctcaccagaaacatcaatgagagaggtg
aaagcggacggagctagcacccccaggttaagagaacaggactgtggtgaacctgcctcg
ccagcagcatccatctccagactctctggggaacaggtcgacgggaagggccaggcaggc
agtgtatctgaaagtgcgcggagtgaaggaaggattagtccaaagagtgatattactgac
actggcctggcacagagcaacaatttgcaggtccccagttcttcagaaccaagcagcctc
aaaggttccacatctctgcttgttcacccggtttcaggagtgagaaaagagcagggaggt
ggttgtcattcagatacttga

DBGET integrated database retrieval system