KEGG   Homo sapiens (human): 8324Help
Entry
8324              CDS       T01001                                 

Gene name
FZD7, FzE3
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  
frizzled 1/7
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Module
Wnt signaling
Disease
H00031  
Breast cancer
H00048  
Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8324 (FZD7)
   04390 Hippo signaling pathway
    8324 (FZD7)
   04150 mTOR signaling pathway
    8324 (FZD7)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8324 (FZD7)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    8324 (FZD7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8324 (FZD7)
   05205 Proteoglycans in cancer
    8324 (FZD7)
   05225 Hepatocellular carcinoma
    8324 (FZD7)
   05226 Gastric cancer
    8324 (FZD7)
   05217 Basal cell carcinoma
    8324 (FZD7)
   05224 Breast cancer
    8324 (FZD7)
  Infectious diseases
   05166 HTLV-I infection
    8324 (FZD7)
   05165 Human papillomavirus infection
    8324 (FZD7)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    8324 (FZD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75084(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.1
AA seq 574 aa AA seqDB search
MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaccccggcgcggccgctccgctttcgtccctgggcctctgtgccctggtgctg
gcgctgctgggcgcactgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgaactccgcttt
ttcttatgctccatgtatgcgcccgtgtgcaccgtgctcgatcaggccatcccgccgtgt
cgttctctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggtgcgggcgagatctgc
gtgggccagaacacgtcggacggctccgggggcccaggcggcggccccactgcctaccct
accgcgccctacctgccggacctgcccttcaccgcgctgcccccgggggcctcagatggc
agggggcgtcccgccttccccttctcatgcccccgtcagctcaaggtgcccccgtacctg
ggctaccgcttcctgggtgagcgcgattgtggcgccccgtgcgaaccgggccgtgccaac
ggcctgatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tccgtgctgtgctgcgcctcgacgctctttaccgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttccttctagaggaccgcgccgtgtgcgtggagcgcttctcg
gacgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctctacttcttcggcatggccagctccatctggtgggtcattctgtctctcact
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggccgtgcccgccgtcaagaccatcactatcctggccatgggc
caggtagacggggacctgctgagcggggtgtgctacgttggcctctccagtgtggacgcg
ctgcggggcttcgtgctggcgcctctgttcgtctacctcttcataggcacgtccttcttg
ctggccggcttcgtgtccctcttccgtatccgcaccatcatgaaacacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacagtg
cccgccaccatcgtcctggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacgtgcaagagctatgccgtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtc
ggcatcaccactggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagacttagccacagcagcaagggggagactgcggtatga

DBGET integrated database retrieval system