KEGG   Homo sapiens (human): 833Help
Entry
833               CDS       T01001                                 

Gene name
CARS, CARS1, CYSRS, MGC:11246
Definition
cysteinyl-tRNA synthetase (EC:6.1.1.16)
Orthology
K01883  
cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    833 (CARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     833 (CARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   833 (CARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    833 (CARS)
 Prokaryotic Type
    833 (CARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 831 aa AA seqDB search
MADSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAFRQLSAPPAD
PQLFHVARWFRHIEALLGSPCGKGQPCRLQASKGRRVQPQWSPPAGTQPCRLHLYNSLTR
NKEVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITD
IDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQH
AVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPK
FWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFAS
SEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPW
GKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHT
GHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEK
FLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTAIHKALCDNVDTRTVMEE
MRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDSSLGFPVGGPGTS
LSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFEDHEGLPT
VVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDK
YSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggcagattcctccgggcagcaggctcctgactacaggtccattctgagcattagtgac
gaggcagccagggcacaagccctgaacgagcacctcagcacgcgtagctatgtccagggg
tactcactgtcccaggcagacgtggacgcgttcaggcagctctcggccccgcccgctgac
ccccagctcttccacgtggctcggtggttcaggcacatagaagcgctcctgggtagcccc
tgtggcaaaggccagccctgcaggctccaagcaagcaaaggccggcgtgtgcagccccag
tggtcccctcctgctgggacccagccatgcagactccacctttacaacagcctcaccagg
aacaaggaagtgttcatacctcaagatgggaaaaaggtgacgtggtattgctgtgggcca
accgtctatgacgcatctcacatggggcacgccaggtcctacatctcttttgatatcttg
agaagagtgttgaaggattacttcaaatttgatgtcttttattgcatgaacattacggat
attgatgacaagatcatcaagagggcccggcagaaccacctgttcgagcagtatcgggag
aagaggcctgaagcggcacagctcttggaggatgttcaggccgccctgaagccattttca
gtaaaattaaatgagaccacggatcccgataaaaagcagatgctcgaacggattcagcac
gcagtgcagcttgccacagagccacttgagaaagctgtgcagtccagactcacgggagag
gaagtcaacagctgtgtggaggtgttgctggaagaagccaaggatttgctctctgactgg
ctggattctacacttggctgtgatgtcactgacaattccatcttctccaagctgcccaag
ttctgggagggggacttccacagagacatggaagctctgaatgttctccctccagatgtc
ttaacccgggttagtgagtatgtgccagaaattgtgaactttgtccagaagattgtggac
aacggttacggctatgtctccaatgggtctgtctactttgatacagcgaagtttgcttct
agcgagaagcactcctatgggaagctggtgcctgaggccgttggagatcagaaagccctt
caagaaggggaaggtgacctgagcatctctgcagaccgcctgagtgagaagcgctctccc
aacgactttgccttatggaaggcctctaagcccggagaaccgtcctggccgtgcccttgg
ggaaagggtcgtccgggctggcatatcgagtgctcggccatggcaggcaccctcctaggg
gcttcgatggacattcacggaggtgggttcgacctccggttcccccaccatgacaatgag
ctggcacagtcggaggcctactttgaaaacgactgctgggtcaggtacttcctgcacaca
ggccacctgaccattgcaggctgcaaaatgtcaaagtcactaaaaaacttcatcaccatt
aaagatgccttgaaaaagcactcagcacggcagttgcggctggccttcctcatgcactcg
tggaaggacaccctggactactccagcaacaccatggagtcagcgcttcaatatgagaag
ttcttgaatgagtttttcttaaatgtgaaagatatccttcgcgctcctgttgacatcact
ggtcagtttgagaagtggggagaagaagaagcagaactgaataagaacttttatgacaag
aagacagcaattcacaaagccctctgtgacaatgttgacacccgcaccgtcatggaagag
atgcgggccttggtcagtcagtgcaacctctatatggcagcccggaaagccgtgaggaag
aggcccaaccaggctctgctggagaacatcgccctgtacctcacccatatgctgaagatc
tttggggccgtagaagaggacagctccctgggattcccggtcggagggcctggaaccagc
ctcagtctcgaggccacagtcatgccctaccttcaggtgttatcagaattccgagaagga
gtgcggaagattgcccgagagcaaaaagtccctgagattctgcagctcagcgatgccctg
cgggacaacatcctgcccgagcttggggtgcggtttgaagaccacgaaggactgcccaca
gtggtgaaactggtagacagaaacaccttattaaaagagagagaagaaaagagacgggtt
gaagaggagaagaggaagaagaaagaggaggcggcccggaggaaacaggaacaagaagca
gcaaagctggccaagatgaagattccccccagtgagatgttcttgtcagaaaccgacaaa
tactccaagtttgatgaaaatggtctgcccacacatgacatggagggcaaagagctcagc
aaagggcaagccaagaagctgaagaagctcttcgaggctcaggagaagctctacaaggaa
tatctgcagatggcccagaatggaagcttccagtga

DBGET integrated database retrieval system