KEGG   Homo sapiens (human): 83439Help
Entry
83439             CDS       T01001                                 

Gene name
TCF7L1, TCF-3, TCF3
Definition
transcription factor 7-like 1 (T-cell specific, HMG-box)
Orthology
K04490  
transcription factor 7-like 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Adherens junction
Melanogenesis
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    83439 (TCF7L1)
   04390 Hippo signaling pathway
    83439 (TCF7L1)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    83439 (TCF7L1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    83439 (TCF7L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    83439 (TCF7L1)
   05210 Colorectal cancer
    83439 (TCF7L1)
   05216 Thyroid cancer
    83439 (TCF7L1)
   05221 Acute myeloid leukemia
    83439 (TCF7L1)
   05217 Basal cell carcinoma
    83439 (TCF7L1)
   05215 Prostate cancer
    83439 (TCF7L1)
   05213 Endometrial cancer
    83439 (TCF7L1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    83439 (TCF7L1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    83439 (TCF7L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 588 aa AA seqDB search
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcggcggcggcggcggcagcgggggaggcggcggc
tccagcgccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatcccc
ttccaggacgaggggggcgaggagcaggagccgagcagcgatagcgcctcggcgcagcgg
gacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcg
gactcggaggcggagaggcgcccgcagcccgtccgggacactttccagaagccgcgggac
tatttcgccgaagtgagaaggcctcaggacagcgcgttctttaaaggacccccgtaccct
gggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggacccctg
tctcccggaggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccctcc
agcgccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagttcct
gtcgttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaatgac
cacttctcccccggctcccctcccacccacctctccccagagatcgatccaaagacagga
atcccccggccccctcacccatccgagctgtcaccgtattacccactctctcccggagct
gtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatgtac
tcccttcctcccggtggcttccggcacccttaccccgccctcgccatgaacgcctcgatg
tccagcctggtctccagtcggttctctcctcacatggtggctcctgcccaccctggcctg
cccacctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccggca
ccccccagcctgagccctgcagtgagcgtgaaatcaccagtcaccgtgaaaaaggaggag
gaaaagaagccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggagatg
agggccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccagatcctt
ggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcccgg
aaggagcggcagcttcactcgcagctctacccaacctggtcagcccgggacaactatggt
aagaaaaagaagaggaagagagaaaagcagctgtcccagacacagtcacagcagcaagtc
caggaggcagagggtgccctggcctccaagagcaagaagccatgtgttcagtacctgccc
cccgagaagccctgtgacagccctgcctcctcccacgggagcatgctggactccccggcc
actccctctgcagctttggcctcaccagctgcccctgctgccacccattcggagcaagcc
cagcccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactctgcc
gccttcctgtcggctaaggctgcagcctcctcctctgggcagatgggcagccagcctccc
ctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctcccccg
tccttccccgccacgctccatgcccaccaggccctcccggtgctacaggcccagcctctt
tccctggtcaccaagtctgcccactaa

DBGET integrated database retrieval system