KEGG   Homo sapiens (human): 83439Help
Entry
83439             CDS       T01001                                 

Gene name
TCF7L1, TCF-3, TCF3
Definition
transcription factor 7-like 1 (T-cell specific, HMG-box)
Orthology
K04490  
transcription factor 7-like 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Adherens junction
Melanogenesis
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 588 aa AA seqDB search
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcggcggcggcggcggcagcgggggaggcggcggc
tccagcgccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatcccc
ttccaggacgaggggggcgaggagcaggagccgagcagcgatagcgcctcggcgcagcgg
gacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcg
gactcggaggcggagaggcgcccgcagcccgtccgggacactttccagaagccgcgggac
tatttcgccgaagtgagaaggcctcaggacagcgcgttctttaaaggacccccgtaccct
gggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggacccctg
tctcccggaggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccctcc
agcgccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagttcct
gtcgttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaatgac
cacttctcccccggctcccctcccacccacctctccccagagatcgatccaaagacagga
atcccccggccccctcacccatccgagctgtcaccgtattacccactctctcccggagct
gtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatgtac
tcccttcctcccggtggcttccggcacccttaccccgccctcgccatgaacgcctcgatg
tccagcctggtctccagtcggttctctcctcacatggtggctcctgcccaccctggcctg
cccacctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccggca
ccccccagcctgagccctgcagtgagcgtgaaatcaccagtcaccgtgaaaaaggaggag
gaaaagaagccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggagatg
agggccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccagatcctt
ggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcccgg
aaggagcggcagcttcactcgcagctctacccaacctggtcagcccgggacaactatggt
aagaaaaagaagaggaagagagaaaagcagctgtcccagacacagtcacagcagcaagtc
caggaggcagagggtgccctggcctccaagagcaagaagccatgtgttcagtacctgccc
cccgagaagccctgtgacagccctgcctcctcccacgggagcatgctggactccccggcc
actccctctgcagctttggcctcaccagctgcccctgctgccacccattcggagcaagcc
cagcccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactctgcc
gccttcctgtcggctaaggctgcagcctcctcctctgggcagatgggcagccagcctccc
ctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctcccccg
tccttccccgccacgctccatgcccaccaggccctcccggtgctacaggcccagcctctt
tccctggtcaccaagtctgcccactaa

DBGET integrated database retrieval system