KEGG   Homo sapiens (human): 83447Help
Entry
83447             CDS       T01001                                 

Gene name
SLC25A31, AAC4, ANT_4, ANT4, SFEC35kDa
Definition
(RefSeq) solute carrier family 25 member 31
  KO
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Necroptosis
Cellular senescence
Parkinson's disease
Huntington's disease
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    83447 (SLC25A31)
   04022 cGMP - PKG signaling pathway
    83447 (SLC25A31)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    83447 (SLC25A31)
   04218 Cellular senescence
    83447 (SLC25A31)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    83447 (SLC25A31)
   05016 Huntington's disease
    83447 (SLC25A31)
  Infectious diseases
   05166 HTLV-I infection
    83447 (SLC25A31)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    83447 (SLC25A31)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   83447 (SLC25A31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H0C2(Tbio)
UniProt: 
Position
4q28.1
AA seq 315 aa AA seqDB search
MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPE
ARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQ
FWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSD
GIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILS
YPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL
YDKIKEFFHIDIGGR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtgagcctgcgaaaaagaaggcagaaaagcggctgtttgacgcctcatccttc
gggaaggaccttctggccggcggagtcgcggcagctgtgtccaagacagcggtggcgccc
atcgagcgggtgaagctgctgctgcaggtgcaggcgtcgtcgaagcagatcagccccgag
gcgcggtacaaaggcatggtggactgcctggtgcggattcctcgcgagcagggtttcttc
agtttttggcgtggcaatttggcaaatgttattcggtattttccaacacaagctctaaac
tttgcttttaaggacaaatacaagcagctattcatgtctggagttaataaagaaaaacag
ttctggaggtggtttttggcaaacctggcttctggtggagctgctggggcaacatcctta
tgtgtagtatatcctctagattttgcccgaacccgattaggtgtcgatattggaaaaggt
cctgaggagcgacaattcaagggtttaggtgactgtattatgaaaatagcaaaatcagat
ggaattgctggtttataccaagggtttggtgtttcagtacagggcatcattgtgtaccga
gcctcttattttggagcttatgacacagttaagggtttattaccaaagccaaagaaaact
ccatttcttgtctcctttttcattgctcaagttgtgactacatgctctggaatactttct
tatccctttgacacagttagaagacgtatgatgatgcagagtggtgaggctaaacggcaa
tataaaggaaccttagactgctttgtgaagatataccaacatgaaggaatcagttccttt
tttcgtggcgccttctccaatgttcttcgcggtacagggggtgctttggtgttggtatta
tatgataaaattaaagaattctttcatattgatattggtggtaggtaa

DBGET integrated database retrieval system