KEGG   Homo sapiens (human): 835Help
Entry
835               CDS       T01001                                 

Gene name
CASP2, CASP-2, ICH1, NEDD-2, NEDD2, PPP1R57
Definition
(RefSeq) caspase 2 (EC:3.4.22.55)
  KO
K02186  
caspase 2 [EC:3.4.22.55]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    835 (CASP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.55  caspase-2
     835 (CASP2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     835 (CASP2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   835 (CASP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q34-q35
AA seq 452 aa AA seqDB search
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLT
TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCT
PEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDV
HVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPT
RSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgagcgcggggtcttggtccaccttccagcacaaggagctgatggccgct
gacaggggacgcaggatattgggagtgtgtggcatgcatcctcatcatcaggaaactcta
aaaaagaaccgagtggtgctagccaaacagctgttgttgagcgaattgttagaacatctt
ctggagaaggacatcatcaccttggaaatgagggagctcatccaggccaaagtgggcagt
ttcagccagaatgtggaactcctcaacttgctgcctaagaggggtccccaagcttttgat
gccttctgtgaagcactgagggagaccaagcaaggccacctggaggatatgttgctcacc
accctttctgggcttcagcatgtactcccaccgttgagctgtgactacgacttgagtctc
ccttttccggtgtgtgagtcctgtcccctttacaagaagctccgcctgtcgacagatact
gtggaacactccctagacaataaagatggtcctgtctgccttcaggtgaagccttgcact
cctgaattttatcaaacacacttccagctggcatataggttgcagtctcggcctcgtggc
ctagcactggtgttgagcaatgtgcacttcactggagagaaagaactggaatttcgctct
ggaggggatgtggaccacagtactctagtcaccctcttcaagcttttgggctatgacgtc
catgttctatgtgaccagactgcacaggaaatgcaagagaaactgcagaattttgcacag
ttacctgcacaccgagtcacggactcctgcatcgtggcactcctctcgcatggtgtggag
ggcgccatctatggtgtggatgggaaactgctccagctccaagaggtttttcagctcttt
gacaacgccaactgcccaagcctacagaacaaaccaaaaatgttcttcatccaggcctgc
cgtggagatgagactgatcgtggggttgaccaacaagatggaaagaaccacgcaggatcc
cctgggtgcgaggagagtgatgccggtaaagaaaagttgccgaagatgagactgcccacg
cgctcagacatgatatgcggctatgcctgcctcaaagggactgccgccatgcggaacacc
aaacgaggttcctggtacatcgaggctcttgctcaagtgttttctgagcgggcttgtgat
atgcacgtggccgacatgctggttaaggtgaacgcacttatcaaggatcgggaaggttat
gctcctggcacagaattccaccggtgcaaggagatgtctgaatactgcagcactctgtgc
cgccacctctacctgttcccaggacaccctcccacatga

DBGET integrated database retrieval system