KEGG   Homo sapiens (human): 8350Help
Entry
8350              CDS       T01001                                 

Gene name
HIST1H3A, H3/A, H3FA
Definition
(RefSeq) histone cluster 1 H3 family member a
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8350 (HIST1H3A)
  Immune diseases
   05322 Systemic lupus erythematosus
    8350 (HIST1H3A)
  Substance dependence
   05034 Alcoholism
    8350 (HIST1H3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8350 (HIST1H3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8350 (HIST1H3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8350
NCBI-ProteinID: NP_003520
OMIM: 602810
HGNC: 4766
Ensembl: ENSG00000275714
Vega: OTTHUMG00000014418
UniProt: P68431
Structure
PDB: 

Jmol
Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag
ttggccactaaggcagcccgcaaaagcgctccggccaccggcggcgtgaaaaagccccac
cgctaccggccgggcaccgtggctctgcgcgagatccgccgttatcagaagtccactgaa
ctgcttattcgtaaactacctttccagcgcctggtgcgcgagattgcgcaggactttaaa
acagacctgcgtttccagagctccgctgtgatggctctgcaggaggcgtgcgaggcctac
ttggtagggctatttgaggacactaacctgtgcgccatccacgccaagcgcgtcactatc
atgcccaaggacatccagctcgcccgccgcatccgcggagagagggcgtga

DBGET integrated database retrieval system