KEGG   Homo sapiens (human): 8351Help
Entry
8351              CDS       T01001                                 

Gene name
HIST1H3D, H3/b, H3FB
Definition
histone cluster 1, H3d
Orthology
K11253  
histone H3
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8351 (HIST1H3D)
  Immune diseases
   05322 Systemic lupus erythematosus
    8351 (HIST1H3D)
  Substance dependence
   05034 Alcoholism
    8351 (HIST1H3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8351 (HIST1H3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p22.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcagactgctcgcaagtccacgggtgggaaagcgccacgcaagcag
ctggccaccaaggctgctcgaaagagcgctccagccaccggcggcgtgaagaagccccac
cgttaccggcccggcacggtggctctgcgcgagatccgccgctaccagaagtcgaccgag
ctgctgattcgcaaactgccattccagcgtctagtccgtgagatcgcgcaggacttcaag
actgatctgcgttttcagagctcggcggtgatggcgctgcaggaggcctgcgaggcctac
ctggtggggctgtttgaggacaccaacctatgcgccattcacgccaagcgagtgactatc
atgcccaaggacatccagcttgctcgccgcattcgtggggagagggcgtaa

DBGET integrated database retrieval system