KEGG   Homo sapiens (human): 8351Help
Entry
8351              CDS       T01001                                 

Gene name
HIST1H3D, H3/b, H3FB
Definition
histone cluster 1, H3d
Orthology
K11253  
histone H3
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p22.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcagactgctcgcaagtccacgggtgggaaagcgccacgcaagcag
ctggccaccaaggctgctcgaaagagcgctccagccaccggcggcgtgaagaagccccac
cgttaccggcccggcacggtggctctgcgcgagatccgccgctaccagaagtcgaccgag
ctgctgattcgcaaactgccattccagcgtctagtccgtgagatcgcgcaggacttcaag
actgatctgcgttttcagagctcggcggtgatggcgctgcaggaggcctgcgaggcctac
ctggtggggctgtttgaggacaccaacctatgcgccattcacgccaagcgagtgactatc
atgcccaaggacatccagcttgctcgccgcattcgtggggagagggcgtaa

DBGET integrated database retrieval system