KEGG   Homo sapiens (human): 83544Help
Entry
83544             CDS       T01001                                 

Gene name
DNAL1, C14orf168, CILD16
Definition
dynein, axonemal, light chain 1
Orthology
K10411  
dynein light chain 1, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Disease
H00564  
Primary ciliary dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    83544 (DNAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 151 aa AA seqDB search
MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELW
ISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAE
NNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggatgcatccttgtccatgcttgctaattgcgagaagctttcactgtctacaaactgc
attgaaaaaattgccaacctgaatggcttaaaaaacttgaggatattatctttaggaaga
aacaacataaagaacttaaatggactggaggcagtaggggacacattagaagaactgtgg
atctcctacaattttattgagaagttgaaagggatccacataatgaagaaattgaagatt
ctctacatgtctaataacctggtaaaagactgggctgagtttgtgaagctggcagaactg
ccatgcctcgaagacctggtgtttgtaggcaatcccttggaagagaaacattctgctgag
aataactggattgaagaagcaaccaagagagtgcccaaactgaaaaagctggatggtact
ccagtaattaaaggggatgaggaagaagacaactaa

DBGET integrated database retrieval system