KEGG   Homo sapiens (human): 83593Help
Entry
83593             CDS       T01001                                 

Gene name
RASSF5, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3
Definition
Ras association (RalGDS/AF-6) domain family member 5
Orthology
K08015  
Ras association domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Leukocyte transendothelial migration
Pathways in cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    83593 (RASSF5)
   04015 Rap1 signaling pathway
    83593 (RASSF5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    83593 (RASSF5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    83593 (RASSF5)
   05223 Non-small cell lung cancer
    83593 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 418 aa AA seqDB search
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtacccgctactattggaccccgag
ccgccgcgctatctacagagcctgagcggccccgagctaccgccgccgccccccgaccgg
tcctcgcgcctctgtgtcccggcgcccctctccactgcgcccggggcgcgcgaggggcgc
agcgcccggagggctgcccgggggaacctggagcccccgccccgggcctcccgacccgct
cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccggcggagcgaggc
gaggggcactgcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcactaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcccgggacaga
ccctctccagaaagcaccctcaccgtgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgcccgcccacactgcaggagatcaagcagaagatcgacagctacaacacg
cgagagaagaactgcctgggcatgaaactgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc
atctatgatgccatcaaggaggtgaacctggcggctaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtagagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system