KEGG   Homo sapiens (human): 83593Help
Entry
83593             CDS       T01001                                 

Gene name
RASSF5, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3
Definition
Ras association (RalGDS/AF-6) domain family member 5
Orthology
K08015  
Ras association domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Leukocyte transendothelial migration
Pathways in cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 418 aa AA seqDB search
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtacccgctactattggaccccgag
ccgccgcgctatctacagagcctgagcggccccgagctaccgccgccgccccccgaccgg
tcctcgcgcctctgtgtcccggcgcccctctccactgcgcccggggcgcgcgaggggcgc
agcgcccggagggctgcccgggggaacctggagcccccgccccgggcctcccgacccgct
cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccggcggagcgaggc
gaggggcactgcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcactaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcccgggacaga
ccctctccagaaagcaccctcaccgtgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgcccgcccacactgcaggagatcaagcagaagatcgacagctacaacacg
cgagagaagaactgcctgggcatgaaactgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc
atctatgatgccatcaaggaggtgaacctggcggctaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtagagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system