KEGG   Homo sapiens (human): 83594Help
Entry
83594             CDS       T01001                                 

Gene name
NUDT12
Definition
nudix (nucleoside diphosphate linked moiety X)-type motif 12 (EC:3.6.1.22)
Orthology
K03426  
NAD+ diphosphatase [EC:3.6.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    83594 (NUDT12)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    83594 (NUDT12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     83594 (NUDT12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q21.2
AA seq 444 aa AA seqDB search
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMCDRSIVNKS
RQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDW
LLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIF
LGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALL
QLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRLCLKEDCPSLNGVHNTSY
PRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVK
VGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQA
FFVPPSRAIAHQLIKHWIRINPNL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtaaaaagaagtctgaagcaagaaatagttactcagtttcactgttcagct
gctgaaggagatattgccaagttaacaggaatactcagtcattctccatctcttctcaat
gaaacttctgaaaatggctggactgctttaatgtgtgacagatcaattgtcaataaatca
aggcagactgcactggacattgctgtattttggggttataagcatatagctaatttacta
gctactgctaaaggtgggaagaagccttggttcctaacgaatgaagtggaagaatgtgaa
aattattttagcaaaacactactggaccggaaaagtgaaaagagaaataattctgactgg
ctgctagctaaagaaagccatccagccacagtttttattcttttctcagatttaaatccc
ttggttactctaggtggcaataaagaaagtttccaacagccagaagttaggctttgtcag
ctgaactacacagatataaaggattatttggcccagcctgagaagatcaccttgattttt
cttggagtagaacttgaaataaaagacaaactacttaattatgctggtgaagtcccgaga
gaggaggaagatggattggttgcctggtttgctctaggtatagatcctattgctgctgaa
gaattcaagcaaagacatgaaaattgttactttcttcatcctcctatgccagcccttctg
caattgaaagaaaaagaagctggggttgtagctcaagcaagatctgttcttgcctggcac
agtcgatacaagttttgcccaacctgtggaaatgcaactaaaattgaagaaggtggctat
aagagattatgtttaaaagaagactgtcctagtctcaatggcgtccataatacctcatac
ccaagagttgatccagtagtaatcatgcaagttattcatccagatgggaccaaatgcctt
ttaggcaggcagaaaagatttcccccaggcatgtttacttgccttgctggatttattgag
cctggagagacaatagaagatgctgttaggagagaagtagaagaggaaagtggagtcaaa
gttggccatgttcagtatgttgcttgtcaaccatggccaatgccttcctccttaatgatt
ggttgcttagctctagcagtgtctacagaaattaaagttgacaagaatgaaatagaggat
gcccgctggttcactagagaacaggtcctggatgttctgaccaaagggaagcagcaggca
ttctttgtgccaccaagccgagctattgcacatcaattaatcaaacactggattagaata
aatcctaatctctaa

DBGET integrated database retrieval system