KEGG   Homo sapiens (human): 83594Help
Entry
83594             CDS       T01001                                 

Gene name
NUDT12
Definition
nudix (nucleoside diphosphate linked moiety X)-type motif 12 (EC:3.6.1.22)
Orthology
K03426  
NAD+ diphosphatase [EC:3.6.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Peroxisome
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hsa00760]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q21.2
AA seq 462 aa AA seqDB search
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPE
IVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENY
FSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtaaaaagaagtctgaagcaagaaatagttactcagtttcactgttcagct
gctgaaggagatattgccaagttaacaggaatactcagtcattctccatctcttctcaat
gaaacttctgaaaatggctggactgctttaatgtatgcggcaaggaatgggcacccagag
atagtccaatttctgcttgagaaagggtgtgacagatcaattgtcaataaatcaaggcag
actgcactggacattgctgtattttggggttataagcatatagctaatttactagctact
gctaaaggtgggaagaagccttggttcctaacgaatgaagtggaagaatgtgaaaattat
tttagcaaaacactactggaccggaaaagtgaaaagagaaataattctgactggctgcta
gctaaagaaagccatccagccacagtttttattcttttctcagatttaaatcccttggtt
actctaggtggcaataaagaaagtttccaacagccagaagttaggctttgtcagctgaac
tacacagatataaaggattatttggcccagcctgagaagatcaccttgatttttcttgga
gtagaacttgaaataaaagacaaactacttaattatgctggtgaagtcccgagagaggag
gaagatggattggttgcctggtttgctctaggtatagatcctattgctgctgaagaattc
aagcaaagacatgaaaattgttactttcttcatcctcctatgccagcccttctgcaattg
aaagaaaaagaagctggggttgtagctcaagcaagatctgttcttgcctggcacagtcga
tacaagttttgcccaacctgtggaaatgcaactaaaattgaagaaggtggctataagaga
ttatgtttaaaagaagactgtcctagtctcaatggcgtccataatacctcatacccaaga
gttgatccagtagtaatcatgcaagttattcatccagatgggaccaaatgccttttaggc
aggcagaaaagatttcccccaggcatgtttacttgccttgctggatttattgagcctgga
gagacaatagaagatgctgttaggagagaagtagaagaggaaagtggagtcaaagttggc
catgttcagtatgttgcttgtcaaccatggccaatgccttcctccttaatgattggttgc
ttagctctagcagtgtctacagaaattaaagttgacaagaatgaaatagaggatgcccgc
tggttcactagagaacaggtcctggatgttctgaccaaagggaagcagcaggcattcttt
gtgccaccaagccgagctattgcacatcaattaatcaaacactggattagaataaatcct
aatctctaa

DBGET integrated database retrieval system