KEGG   Homo sapiens (human): 83667Help
Entry
83667             CDS       T01001                                 

Gene name
SESN2, HI95, SES2, SEST2
Definition
(RefSeq) sestrin 2
  KO
K20394  sestrin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    83667 (SESN2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    83667 (SESN2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    83667 (SESN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA26 CMD DUF1752
Motif
Other DBs
NCBI-GeneID: 83667
NCBI-ProteinID: NP_113647
OMIM: 607767
HGNC: 20746
Ensembl: ENSG00000130766
Vega: OTTHUMG00000003532
Pharos: P58004(Tbio)
UniProt: P58004
Structure
PDB: 

Jmol
Position
1p35.3
AA seq 480 aa AA seqDB search
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSP
PSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggcggactccgagtgccgcgcagagctcaaggactacctgcggttcgccccg
ggcggcgtcggcgactcgggccccggagaggagcagagggagagccgggctcggcgaggc
cctcgagggcccagcgccttcatccccgtggaggaggtccttcgggagggggctgagagc
ctcgagcagcacctggggctggaggcactgatgtcctctgggcgagtagacaacctggca
gtggtgatgggcctgcaccctgactactttaccagcttctggcgcctgcactacctgctg
ctgcacacggatggtcccttggccagctcctggcgccactacattgccatcatggctgcc
gcccgccatcagtgttcttacctggtaggctcccacatggccgagtttctgcagactggt
ggtgaccctgagtggctgctgggcctccaccgggcccccgagaagctgcgcaaactcagc
gagatcaacaagttgctggcgcatcggccatggctcatcaccaaggaacacatccaggcc
ttgctgaagaccggcgagcacacttggtccctggccgagctcattcaggctctggtcctg
ctcacccactgccactcgctctcctccttcgtgtttggctgtggcatcctccctgagggg
gatgcagatggcagccctgccccccaggcacctacaccccctagtgaacagagcagcccc
ccaagcagggacccgttgaacaactctgggggctttgagtctgcccgcgacgtggaggcg
ctgatggagcgcatgcagcagctgcaggagagcctgctgcgggatgaggggacgtcccag
gaggagatggagagccgctttgagctggagaagtcagagagcctgctggtgaccccctca
gctgacatcctggagccctctccacacccagacatgctgtgctttgtggaagaccctact
ttcggatatgaggacttcactcggagaggggctcaggcaccccctaccttccgggcccag
gattatacctgggaagaccatggctactcgctgatccagcggctttaccctgagggtggg
cagctgctggatgagaagttccaggcagcctatagcctcacctacaataccatcgccatg
cacagtggtgtggacacctccgtgctccgcagggccatctggaactatatccactgcgtc
tttggcatcagatatgatgactatgattatggggaggtgaaccagctcctggagcggaac
ctcaaggtctatatcaagacagtggcctgctacccagagaagaccacccgaagaatgtac
aacctcttctggaggcacttccgccactcagagaaggtccacgtgaacttgctgctcctg
gaggcgcgcatgcaagccgctctgctgtacgccctccgtgccatcacccgctacatgacc
tga

DBGET integrated database retrieval system