KEGG   Homo sapiens (human): 83667Help
Entry
83667             CDS       T01001                                 

Gene name
SESN2, HI95, SES2, SEST2
Definition
sestrin 2
Orthology
K10141  
sestrin
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    83667 (SESN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35.3
AA seq 480 aa AA seqDB search
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSP
PSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggcggactccgagtgccgcgcagagctcaaggactacctgcggttcgccccg
ggcggcgtcggcgactcgggccccggagaggagcagagggagagccgggctcggcgaggc
cctcgagggcccagcgccttcatccccgtggaggaggtccttcgggagggggctgagagc
ctcgagcagcacctggggctggaggcactgatgtcctctgggcgagtagacaacctggca
gtggtgatgggcctgcaccctgactactttaccagcttctggcgcctgcactacctgctg
ctgcacacggatggtcccttggccagctcctggcgccactacattgccatcatggctgcc
gcccgccatcagtgttcttacctggtaggctcccacatggccgagtttctgcagactggt
ggtgaccctgagtggctgctgggcctccaccgggcccccgagaagctgcgcaaactcagc
gagatcaacaagttgctggcgcatcggccatggctcatcaccaaggaacacatccaggcc
ttgctgaagaccggcgagcacacttggtccctggccgagctcattcaggctctggtcctg
ctcacccactgccactcgctctcctccttcgtgtttggctgtggcatcctccctgagggg
gatgcagatggcagccctgccccccaggcacctacaccccctagtgaacagagcagcccc
ccaagcagggacccgttgaacaactctgggggctttgagtctgcccgcgacgtggaggcg
ctgatggagcgcatgcagcagctgcaggagagcctgctgcgggatgaggggacgtcccag
gaggagatggagagccgctttgagctggagaagtcagagagcctgctggtgaccccctca
gctgacatcctggagccctctccacacccagacatgctgtgctttgtggaagaccctact
ttcggatatgaggacttcactcggagaggggctcaggcaccccctaccttccgggcccag
gattatacctgggaagaccatggctactcgctgatccagcggctttaccctgagggtggg
cagctgctggatgagaagttccaggcagcctatagcctcacctacaataccatcgccatg
cacagtggtgtggacacctccgtgctccgcagggccatctggaactatatccactgcgtc
tttggcatcagatatgatgactatgattatggggaggtgaaccagctcctggagcggaac
ctcaaggtctatatcaagacagtggcctgctacccagagaagaccacccgaagaatgtac
aacctcttctggaggcacttccgccactcagagaaggtccacgtgaacttgctgctcctg
gaggcgcgcatgcaagccgctctgctgtacgccctccgtgccatcacccgctacatgacc
tga

DBGET integrated database retrieval system