KEGG   Homo sapiens (human): 83700Help
Entry
83700             CDS       T01001                                 

Gene name
JAM3, JAM-2, JAM-3, JAM-C, JAMC
Definition
(RefSeq) junctional adhesion molecule 3
  KO
K06785  
junctional adhesion molecule 3
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Epithelial cell signaling in Helicobacter pylori infection
Disease
H01301  
Hemorrhagic destruction of the brain, subependymal calcification, and cataracts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    83700 (JAM3)
 Cellular Processes
  Cellular community
   04530 Tight junction
    83700 (JAM3)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    83700 (JAM3)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    83700 (JAM3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   F11R, JAM1; junctional adhesion molecule 1 [KO:K06089]
    83700 (JAM3)
   JAM2; junctional adhesion molecule 2 [KO:K06735]
    83700 (JAM3)
   JAM3; junctional adhesional molecule 3 [KO:K06785]
    83700 (JAM3)
 2. Integrin Family
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     83700 (JAM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q25
AA seq 310 aa AA seqDB search
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQT
SDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVAR
NDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPL
PTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDL
NIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEG
DFRHKSSFVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggcggccaccgcgactccggctctgcgctcggctgcctgacttcttcctg
ctgctgcttttcaggggctgcctgataggggctgtaaatctcaaatccagcaatcgaacc
ccagtggtacaggaatttgaaagtgtggaactgtcttgcatcattacggattcgcagaca
agtgaccccaggatcgagtggaagaaaattcaagatgaacaaaccacatatgtgtttttt
gacaacaaaattcagggagacttggcgggtcgtgcagaaatactggggaagacatccctg
aagatctggaatgtgacacggagagactcagccctttatcgctgtgaggtcgttgctcga
aatgaccgcaaggaaattgatgagattgtgatcgagttaactgtgcaagtgaagccagtg
acccctgtctgtagagtgccgaaggctgtaccagtaggcaagatggcaacactgcactgc
caggagagtgagggccacccccggcctcactacagctggtatcgcaatgatgtaccactg
cccacggattccagagccaatcccagatttcgcaattcttctttccacttaaactctgaa
acaggcactttggtgttcactgctgttcacaaggacgactctgggcagtactactgcatt
gcttccaatgacgcaggctcagccaggtgtgaggagcaggagatggaagtctatgacctg
aacattggcggaattattgggggggttctggttgtccttgctgtactggccctgatcacg
ttgggcatctgctgtgcatacagacgtggctacttcatcaacaataaacaggatggagaa
agttacaagaacccagggaaaccagatggagttaactacatccgcactgacgaggagggc
gacttcagacacaagtcatcgtttgtgatctga

DBGET integrated database retrieval system