KEGG   Homo sapiens (human): 83715Help
Entry
83715             CDS       T01001                                 

Gene name
ESPN, DFNB36, LP2654
Definition
(RefSeq) espin
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.31
AA seq 854 aa AA seqDB search
MALEQALQAARQGELDVLRSLHAAGLLGPSLRDPLDALPVHHAARAGKLHCLRFLVEEAA
LPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVV
NWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLAC
QEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDG
ATAMHFAASRGHTKVLSWLLLHGGEISADLWGGTPLHDAAENGELECCQILVVNGAELDV
RDRDGYTAADLSDFNGHSHCTRYLRTVENLSVEHRVLSRDPSAELEAKQPDSGMSSPNTT
VSVQPLNFDLSSPTSTLSNYDSCSSSHSSIKGQHPPCGLSSARAADIQSYMDMLNPELGL
PRGTIGKPTPPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPPVGPQAADIYMQTKNKLRHV
ETEALKKELSSCDGHDGLRRQDSSRKPRAFSKQPSTGDYYRQLGRCPGETLAARPGMAHS
EEVRARQPARAGCPRLGPAARGSLEGPSAPPQAALLPGNHVPNGCAADPKASRELPPPPP
PPPPPLPEAASSPPPAPPLPLESAGPGCGQRRSSSSTGSTKSFNMMSPTGDNSELLAEIK
AGKSLKPTPQSKGLTTVFSGIGQPAFQPDSPLPSVSPALSPVRSPTPPAAGFQPLLNGSL
VPVPPTTPAPGVQLDVEALIPTHDEQGRPIPEWKRQVMVRKMQLKMQEEEEQRRKEEEEE
ARLASMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPW
QRQVILKKGDIAKY
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggccctggagcaggcgctgcaggcggcgcggcagggcgagctggacgtgctgaggtcg
ctgcacgccgcaggcctcctggggccctcgctgcgcgacccgctggacgcgctgcccgtg
caccacgcggcccgcgctgggaagctgcactgtctgcgcttcctggtggaggaagccgcc
ctccccgccgcggcccgcgcccgcaacggcgccacaccggcccacgacgcctccgccacc
ggccacctcgcctgcctgcagtggctgctgtcgcagggcggctgcagagtgcaggacaaa
gacaattctggtgccacagtcttgcatctggctgcccgcttcggccaccccgaggtggtg
aactggctcttgcatcatggcggtggggaccccaccgcggccacagacatgggcgccctg
cctatccactacgctgccgccaaaggagacttcccctccctgaggcttctcgtcgagcac
taccctgagggagtgaatgcccaaaccaagaacggtgccacgcccctgtacctggcgtgc
caggagggccacctggaggtgacccagtacctggtgcaggaatgcggcgcagacccgcac
gcgcgcgcccacgacggcatgaccccgctgcacgccgcggcgcagatgggccacagccca
gtcatcgtgtggttggtgagctgcaccgacgtgagcctgtccgagcaggacaaagacggc
gccaccgccatgcacttcgcggcgagccgcggccacaccaaggtgctcagctggctgctg
ctgcacggcggggagatctcggctgacctgtggggcgggaccccgctgcacgacgccgcc
gagaacggggagctagagtgctgccagatcctggtagtgaacggcgcggagctggacgtc
cgcgaccgcgacgggtacacggccgccgacctgtcggacttcaacggccacagccactgc
acccgctacctgcgcacggtggagaacctgagcgtggagcaccgcgtgctttcccgggat
ccatccgcagagctggaggctaagcagccggattcaggcatgtcctcacccaataccacg
gtgtcggtccagccgctgaactttgacctcagctcgcctaccagcaccctctccaactac
gactcctgctcctccagccactccagcatcaagggccagcaccctccatgtgggctttcc
agcgctagagctgcagacatacagagctacatggacatgctgaacccggagctgggcctg
cctcggggcacgattgggaagcccacacccccaccacccccacccagcttccccccgcca
cccccgcccccaggcacccaactgcccccacccccacctggctacccagctcccaagcct
cctgtaggaccacaggcagctgacatctacatgcagaccaagaacaaactccgccacgtg
gagacagaggccctcaagaaggagctgagctcctgtgacggccacgacgggctgcggagg
caggactccagccgcaagccccgcgccttcagcaagcagcccagcacgggggactactac
cggcagctgggccgctgccccggcgagacgctggccgcacgcccgggcatggcgcacagc
gaggaggtgcgtgcccgccagcccgcgcgcgccggctgcccgcgcctcggccctgccgcc
cgcggctcactcgaaggcccctccgctcccccgcaggcggcgctgcttcctgggaaccat
gttcctaacggctgcgccgcggaccccaaggcgtccagggagctgccaccgccgccccca
ccgccgccgccgcccctgccggaggccgcgagttcgccaccgccggccccgcctctgccc
ctcgagagcgctggccctggctgcgggcagcgccgctcctcctcgtccaccggcagcacc
aagtctttcaacatgatgtccccgacgggcgacaactcggagctactggctgagattaag
gcaggcaagagcctgaagccgacgccccagagcaaggggctgaccacagtgttctcaggc
atcgggcagccggccttccagcccgattcgccgctgccttctgtgtcacctgcactgtca
ccagtccggagccccacaccgccagctgcggggtttcagccgctgctcaatggaagcttg
gttcccgtgccgcccactactcctgcgccgggagtgcagctggacgtggaggctctcatc
cccacgcacgatgagcagggccggcccatccccgagtggaagcgccaggtgatggtgcgc
aagatgcagctgaagatgcaggaggaggaggagcagaggcggaaggaggaggaggaggag
gcccggctggccagcatgcccgcctggaggcgggacctcctgcggaagaagctggaagaa
gagagggagcagaagcggaaagaggaggagcgacagaagcaggaggagctgcggcgggag
aaggaacagtcagagaagctgcggacgctgggctacgatgagagcaagctggcgccctgg
cagcgacaggtcatcctgaagaagggggacatcgctaagtactag

DBGET integrated database retrieval system