KEGG   Homo sapiens (human): 8372Help
Entry
8372              CDS       T01001                                 

Gene name
HYAL3, HYAL-3, LUCA-3, LUCA3
Definition
hyaluronoglucosaminidase 3 (EC:3.2.1.35)
Orthology
K01197  
hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Module
Dermatan sulfate degradation
Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    8372 (HYAL3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     8372 (HYAL3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Enzymes (General comment) Variety
  8372 (HYAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 417 aa AA seqDB search
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcaactgggcccagccctggtgctgggggtggccctgtgcctgggttgtggc
cagcccctaccacaggtccctgaacgccccttctctgtgctgtggaatgtaccctcagca
cactgtgaggcccgctttggtgtgcacctgccactcaatgctctgggcatcatagccaac
cgtggccagcattttcacggtcagaacatgaccattttctacaagaaccaactcggcctc
tatccctactttggacccaggggcacagctcacaatgggggcatcccccaggctttgccc
cttgaccgccacctggcactggctgcctaccagatccaccacagcctgagacctggcttt
gctggcccagcagtgctggattgggaggagtggtgtccactctgggctgggaactggggc
cgccgccgagcttatcaggcagcctcttgggcttgggcacagcaggtattccctgacctg
gaccctcaggagcagctctacaaggcctatactggctttgagcaggcggcccgtgcactg
atggaggatacgctgcgggtggcccaggcactacggccccatggactctggggcttctat
cactacccagcctgtggcaatggctggcatagtatggcttccaactataccggccgctgc
catgcagccacccttgcccgcaacactcaactgcattggctctgggccgcctccagtgcc
ctcttccccagcatctacctcccacccaggctgccacctgcccaccaccaggcctttgtc
cgacatcgcctggaggaggccttccgtgtggcccttgttgggcaccgacatcccctgcct
gtcctggcctatgtccgcctcacacaccggagatctgggaggttcctgtcccaggatgac
cttgtgcagtccattggtgtgagtgcagcactaggggcagccggcgtggtgctctggggg
gacctgagcctctccagctctgaggaggagtgctggcatctccatgactacctggtggac
accttgggcccctatgtgatcaatgtgaccagggcagcgatggcctgcagtcaccagcgg
tgccatggccacgggcgctgtgcccggcgagatccaggacagatggaagcctttctacac
ctgtggccagacggcagccttggagattggaagtccttcagctgccactgttactggggc
tgggctggccccacctgccaggagcccaggcctgggcctaaagaagcagtataa

DBGET integrated database retrieval system