KEGG   Homo sapiens (human): 83756Help
Entry
83756             CDS       T01001                                 

Gene name
TAS1R3, T1R3
Definition
taste receptor, type 1, member 3
Orthology
K04626  
taste receptor type 1 member 3
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Carbohydrate digestion and absorption
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    83756 (TAS1R3)
  Sensory system
   04742 Taste transduction
    83756 (TAS1R3)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Chemoreception
   Taste type 1
    83756 (TAS1R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
1p36.33
AA seq 852 aa AA seqDB search
MLGPAVLGLSLWALLHPGTGAPLCLSQQLRMKGDYVLGGLFPLGEAEEAGLRSRTRPSSP
VCTRFSSNGLLWALAMKMAVEEINNKSDLLPGLRLGYDLFDTCSEPVVAMKPSLMFLAKA
GSRDIAAYCNYTQYQPRVLAVIGPHSSELAMVTGKFFSFFLMPQVSYGASMELLSARETF
PSFFRTVPSDRVQLTAAAELLQEFGWNWVAALGSDDEYGRQGLSIFSALAAARGICIAHE
GLVPLPRADDSRLGKVQDVLHQVNQSSVQVVLLFASVHAAHALFNYSISSRLSPKVWVAS
EAWLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQG
LEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAAVYSVAQALHNTLQCNASGCPAQDP
VKPWQLLENMYNLTFHVGGLPLRFDSSGNVDMEYDLKLWVWQGSVPRLHDVGRFNGSLRT
ERLKIRWHTSDNQKPVSRCSRQCQEGQVRRVKGFHSCCYDCVDCEAGSYRQNPDDIACTF
CGQDEWSPERSTRCFRRRSRFLAWGEPAVLLLLLLLSLALGLVLAALGLFVHHRDSPLVQ
ASGGPLACFGLVCLGLVCLSVLLFPGQPSPARCLAQQPLSHLPLTGCLSTLFLQAAEIFV
ESELPLSWADRLSGCLRGPWAWLVVLLAMLVEVALCTWYLVAFPPEVVTDWHMLPTEALV
HCRTRSWVSFGLAHATNATLAFLCFLGTFLVRSQPGRYNRARGLTFAMLAYFITWVSFVP
LLANVQVVLRPAVQMGALLLCVLGILAAFHLPRCYLLMRQPGLNTPEFFLGGGPGDAQGQ
NDGNTGNQGKHE
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgctgggccctgctgtcctgggcctcagcctctgggctctcctgcaccctgggacgggg
gccccattgtgcctgtcacagcaacttaggatgaagggggactacgtgctgggggggctg
ttccccctgggcgaggccgaggaggctggcctccgcagccggacacggcccagcagccct
gtgtgcaccaggttctcctcaaacggcctgctctgggcactggccatgaaaatggccgtg
gaggagatcaacaacaagtcggatctgctgcccgggctgcgcctgggctacgacctcttt
gatacgtgctcggagcctgtggtggccatgaagcccagcctcatgttcctggccaaggca
ggcagccgcgacatcgccgcctactgcaactacacgcagtaccagccccgtgtgctggct
gtcatcgggccccactcgtcagagctcgccatggtcaccggcaagttcttcagcttcttc
ctcatgccccaggtcagctacggtgctagcatggagctgctgagcgcccgggagaccttc
ccctccttcttccgcaccgtgcccagcgaccgtgtgcagctgacggccgccgcggagctg
ctgcaggagttcggctggaactgggtggccgccctgggcagcgacgacgagtacggccgg
cagggcctgagcatcttctcggccctggccgcggcacgcggcatctgcatcgcgcacgag
ggcctggtgccgctgccccgtgccgatgactcgcggctggggaaggtgcaggacgtcctg
caccaggtgaaccagagcagcgtgcaggtggtgctgctgttcgcctccgtgcacgccgcc
cacgccctcttcaactacagcatcagcagcaggctctcgcccaaggtgtgggtggccagc
gaggcctggctgacctctgacctggtcatggggctgcccggcatggcccagatgggcacg
gtgcttggcttcctccagaggggtgcccagctgcacgagttcccccagtacgtgaagacg
cacctggccctggccaccgacccggccttctgctctgccctgggcgagagggagcagggt
ctggaggaggacgtggtgggccagcgctgcccgcagtgtgactgcatcacgctgcagaac
gtgagcgcagggctaaatcaccaccagacgttctctgtctacgcagctgtgtatagcgtg
gcccaggccctgcacaacactcttcagtgcaacgcctcaggctgccccgcgcaggacccc
gtgaagccctggcagctcctggagaacatgtacaacctgaccttccacgtgggcgggctg
ccgctgcggttcgacagcagcggaaacgtggacatggagtacgacctgaagctgtgggtg
tggcagggctcagtgcccaggctccacgacgtgggcaggttcaacggcagcctcaggaca
gagcgcctgaagatccgctggcacacgtctgacaaccagaagcccgtgtcccggtgctcg
cggcagtgccaggagggccaggtgcgccgggtcaaggggttccactcctgctgctacgac
tgtgtggactgcgaggcgggcagctaccggcaaaacccagacgacatcgcctgcaccttt
tgtggccaggatgagtggtccccggagcgaagcacacgctgcttccgccgcaggtctcgg
ttcctggcatggggcgagccggctgtgctgctgctgctcctgctgctgagcctggcgctg
ggccttgtgctggctgctttggggctgttcgttcaccatcgggacagcccactggttcag
gcctcgggggggcccctggcctgctttggcctggtgtgcctgggcctggtctgcctcagc
gtcctcctgttccctggccagcccagccctgcccgatgcctggcccagcagcccttgtcc
cacctcccgctcacgggctgcctgagcacactcttcctgcaggcggccgagatcttcgtg
gagtcagaactgcctctgagctgggcagaccggctgagtggctgcctgcgggggccctgg
gcctggctggtggtgctgctggccatgctggtggaggtcgcactgtgcacctggtacctg
gtggccttcccgccggaggtggtgacggactggcacatgctgcccacggaggcgctggtg
cactgccgcacacgctcctgggtcagcttcggcctagcgcacgccaccaatgccacgctg
gcctttctctgcttcctgggcactttcctggtgcggagccagccgggccgctacaaccgt
gcccgtggcctcacctttgccatgctggcctacttcatcacctgggtctcctttgtgccc
ctcctggccaatgtgcaggtggtcctcaggcccgccgtgcagatgggcgccctcctgctc
tgtgtcctgggcatcctggctgccttccacctgcccaggtgttacctgctcatgcggcag
ccagggctcaacacccccgagttcttcctgggagggggccctggggatgcccaaggccag
aatgacgggaacacaggaaatcaggggaaacatgagtga

DBGET integrated database retrieval system