KEGG   Homo sapiens (human): 8379Help
Entry
8379              CDS       T01001                                 

Gene name
MAD1L1, MAD1, PIG9, TP53I9, TXBP181
Definition
MAD1 mitotic arrest deficient-like 1 (yeast)
Orthology
K06638  
mitotic spindle assembly checkpoint protein MAD1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Progesterone-mediated oocyte maturation
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8379 (MAD1L1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8379 (MAD1L1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8379 (MAD1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p22
AA seq 718 aa AA seqDB search
MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRS
KSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGA
EEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRV
KRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAA
IVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETL
VGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSAR
GLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKML
KSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRT
KVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKE
VAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPG
DCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctgggggaaaacaccatggttttatccaccctgagatctttgaacaacttc
atctctcagcgtgtggagggaggctctggactggatatttctacctcggccccaggttct
ctgcagatgcagtaccagcagagcatgcagctggaggaaagagcagagcagatccgttcg
aagtcccacctcatccaggtggagcgggagaaaatgcagatggagctgagtcacaagagg
gctcgagtggagctggagagagcagccagcaccagtgccaggaactacgagcgtgaggtc
gaccgcaaccaggagctcctgacgcgcatccggcagcttcaggagcgggaggccggggcg
gaggagaagatgcaggagcagctggagcgcaacaggcagtgtcagcagaacttggatgct
gccagcaagaggctgcgtgagaaagaggacagtctggcccaggctggcgagaccatcaac
gcactgaaggggaggatctcggaactgcagtggagcgtgatggaccaggagatgcgggtg
aagcgcctggagtcggagaagcaggagctgcaggagcagctggacctgcaacacaaaaaa
tgccaggaagccaatcagaaaatccaggaactccaggccagccaagaagcaagagcagac
cacgagcagcagattaaggatctggagcagaagctgtccctgcaagagcaggatgcagcg
attgtgaagaacatgaagtctgagctggtacggctccctaggctggaacgggagctgaag
cagctgcgggaggagagcgcgcacctgcgggagatgagagagaccaacgggctgctccag
gaagagctggaagggctgcagaggaagctggggcgccaggagaagatgcaggagacgctg
gttggcttggagctggagaacgagaggctgctggccaagctgcaaagctgggagagactg
gaccagaccatgggcctgagcatcaggactccagaagacctttccagattcgtggttgag
ctgcagcagagggagcttgccttgaaggacaagaacagcgccgtcaccagcagcgcccgg
gggctggagaaggccaggcagcagctgcaggaggagctccggcaggtcagcggccagctg
ttggaggagaggaagaagcgcgagacccacgaggcgctggcccggaggctccagaaacgg
gtcctgctgctcaccaaggagcgggacggtatgcgggccatcctggggtcctacgacagc
gagctgaccccggccgagtactcaccccagctgacgcggcgcatgcgggaggctgaggat
atggtgcagaaggtgcacagccacagcgccgagatggaggctcagctgtcgcaggccctg
gaggagctgggaggccagaaacaaagagcagacatgctggagatggagctgaagatgctg
aagtctcagtccagctctgccgaacagagcttcctgttctccagggaggaggcggacacg
ctcaggttgaaggtcgaggagctggaaggcgagcggagtcggctggaggaggaaaagagg
atgctggaggcacagctggagcggcgagctctgcagggtgactatgaccagagcaggacc
aaagtgctgcacatgagcctgaaccccaccagtgtggccaggcagcgcctgcgcgaggac
cacagccagctgcaggcggagtgcgagcgactgcgcgggctcctgcgcgccatggagaga
ggaggcaccgtcccagccgaccttgaggctgccgccgcgagtctgccatcgtccaaggag
gtggcagagctgaagaagcaggtggagagtgccgagctgaagaaccagcggctcaaggag
gttttccagaccaagatccaggagttccgcaaggcctgctacacgctcaccggctaccag
atcgacatcaccacggagaaccagtaccggctgacctcgctgtacgccgagcacccaggc
gactgcctcatcttcaaggccaccagcccctcgggttccaagatgcagctactggagaca
gagttctcacacaccgtgggcgagctcatcgaggtgcacctgcggcgccaggacagcatc
cctgccttcctcagctcgctcaccctcgagctcttcagccgccagaccgtggcgtag

DBGET integrated database retrieval system