KEGG   Homo sapiens (human): 83795Help
Entry
83795             CDS       T01001                                 

Gene name
KCNK16, K2p16.1, TALK-1, TALK1
Definition
(RefSeq) potassium two pore domain channel subfamily K member 16
  KO
K04924  
potassium channel subfamily K member 16
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   83795 (KCNK16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.2-p21.1
AA seq 309 aa AA seqDB search
MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF
PISKKGLGS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgctgggctctgcagctgctggggtggccgggtgctgcccctgctgctggcc
tatgtctgctacctgctgctcggtgccactatcttccagctgctagagaggcaggcggag
gctcagtccagggaccagtttcagttggagaagctgcgcttcctggagaactacacctgc
ctggaccagtgggccatggagcagtttgtgcaggtcatcatggaagcctgggtgaaaggt
gtgaaccccaaaggcaactctaccaaccccagcaactgggactttggcagcagtttcttc
tttgcaggcacagtcgtcactaccataggatatgggaacctggcacccagcacagaggca
ggtcaggtcttctgtgtcttctatgccctgttgggcatcccgcttaacgtgatcttcctc
aaccacctgggcacagggctgcgtgcccatctggccgccattgaaagatgggaggaccgt
cccaggcgctcccaggtactgcaagtcctgggcctggctctgttcctgaccctggggacg
ctggtcattctcatcttcccacccatggtcttcagccatgtggagggctggagcttcagc
gagggcttctactttgctttcatcactctcagcaccattggctttggggactatgttgtt
ggcacagaccccagcaagcattatatctcagtgtatcggagcctggcagccatctggatc
ctcctgggcctggcgtggctggcgctgatcctcccactgggccccctgcttctgcacaga
tgctgccagctctggctgctcagtctgaggcaaggctgtggagccaaggcggctccaggc
aggagacccaggagaggctctacagcagcaagaggagtccaagtcacaccccaggacttc
cccatatccaagaaaggactgggaagctga

DBGET integrated database retrieval system