KEGG   Homo sapiens (human): 8382Help
Entry
8382              CDS       T01001                                 

Gene name
NME5, NM23-H5, NM23H5, RSPH23
Definition
NME/NM23 family member 5
Orthology
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31
AA seq 212 aa AA seqDB search
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVE
KYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPIVEEPY
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagatatcaatgcctccacctcagatatatgtagaaaaaactctggccattatcaaa
ccagatattgttgacaaagaggaggagatacaagatattattcttagatccggattcacc
attgttcagagaagaaaactacgcctcagccctgagcaatgtagtaacttttatgtggaa
aagtatggaaaaatgtttttccccaacttaacagcttacatgagttctggaccacttgtc
gccatgatattagctagacataaagccatctcttattggttagaacttttgggaccaaat
aatagcttagtagcgaaggagacacatccagacagtctgagggcaatttatggcacagat
gacctaaggaatgcacttcatgggagtaatgactttgctgctgcggaaagagaaatacgt
tttatgtttcctgaagtgattgttgagcccattccaattggacaagctgctaaggactat
ttaaatttacatataatgccaactctgcttgaaggactcacagagctttgtaagcaaaaa
ccagcagatcctttgatttggctagctgattggctgctgaaaaataatcctaacaaaccc
aaactttgtcaccatccaattgtagaagaaccttattaa

DBGET integrated database retrieval system