KEGG   Homo sapiens (human): 8382Help
Entry
8382              CDS       T01001                                 

Gene name
NME5, NM23-H5, NM23H5, RSPH23
Definition
(RefSeq) NME/NM23 family member 5
  KO
K20790  
nucleoside diphosphate kinase homolog 5
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    8382 (NME5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P56597(Tbio)
UniProt: 
Position
5q31.2
AA seq 212 aa AA seqDB search
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVE
KYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPIVEEPY
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagatatcaatgcctccacctcagatatatgtagaaaaaactctggccattatcaaa
ccagatattgttgacaaagaggaggagatacaagatattattcttagatccggattcacc
attgttcagagaagaaaactacgcctcagccctgagcaatgtagtaacttttatgtggaa
aagtatggaaaaatgtttttccccaacttaacagcttacatgagttctggaccacttgtc
gccatgatattagctagacataaagccatctcttattggttagaacttttgggaccaaat
aatagcttagtagcgaaggagacacatccagacagtctgagggcaatttatggcacagat
gacctaaggaatgcacttcatgggagtaatgactttgctgctgcggaaagagaaatacgt
tttatgtttcctgaagtgattgttgagcccattccaattggacaagctgctaaggactat
ttaaatttacatataatgccaactctgcttgaaggactcacagagctttgtaagcaaaaa
ccagcagatcctttgatttggctagctgattggctgctgaaaaataatcctaacaaaccc
aaactttgtcaccatccaattgtagaagaaccttattaa

DBGET integrated database retrieval system