KEGG   Homo sapiens (human): 8383Help
Entry
8383              CDS       T01001                                 

Gene name
OR1A1, OR17-7
Definition
olfactory receptor, family 1, subfamily A, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    8383 (OR1A1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    8383 (OR1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 309 aa AA seqDB search
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMY
FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
GSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALR
KLFNKRISS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaaataaccagtcctctacactggaattcatcctcctgggagttactggtcag
caggaacaggaagatttcttctacatcctcttcttgttcatttaccccatcacattgatt
ggaaacctgctcatcgtcctagccatttgctctgatgttcgccttcacaaccccatgtat
tttctccttgccaacctctccttggttgacatcttcttctcatcggtaaccatccctaag
atgctggccaaccatctcttgggcagcaaatccatctcttttgggggatgcctaacgcag
atgtatttcatgatagccttgggtaacacagacagctatattttggctgcaatggcatat
gatcgagctgtggccatcagccgcccacttcactacacaacaattatgagtccacggtct
tgtatctggcttattgctgggtcttgggtgattggaaatgccaatgccctcccccacact
ctgctcacagctagtctgtccttctgtggcaaccaggaagtggccaacttctactgtgac
attacccccttgctgaagttatcctgttctgacatccactttcatgtgaagatgatgtac
ctaggggttggcattttctctgtgccattactatgcatcattgtctcctatattcgagtc
ttctccacagtcttccaggttccttccaccaagggcgtgctcaaggccttctccacctgt
ggttcccacctcacggttgtctctttgtattatggtacagtcatgggcacgtatttccgc
cctttgaccaattatagcctaaaagacgcagtgatcactgtaatgtacacggcagtgacc
ccaatgttaaatcctttcatctacagtctgagaaatcgggacatgaaggctgccctgcgg
aaactcttcaacaagagaatctcctcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system