KEGG   Homo sapiens (human): 83852Help
Entry
83852             CDS       T01001                                 

Gene name
SETDB2, C13orf4, CLLD8, CLLL8, KMT1F
Definition
(RefSeq) SET domain bifurcated 2 (EC:2.1.1.43)
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    83852 (SETDB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     83852 (SETDB2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     83852 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    83852 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14
AA seq 719 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKGASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKE
ILSLEDKVVDFREKDSSSNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKT
NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEV
VSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCI
DITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRV
VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTVETKYDNI
SRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDS
SSNHVDEFEDNLLIESDVIDITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGR
STACQRQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLV
QNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaagggagcatcacagaaagaagtgaatgcccaaagc
agtgatcctatgcctgtgactcagaaggaacaggaaaacaaatccaatgcatttccctct
acatcatgtgaaaactcctttccagaagactgtacatttctaacaacagaaaataaggaa
attctctctcttgaagataaagttgtagactttagagaaaaagactcatcttcgaattta
tcttaccaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaacttgaag
ggagaaaaccctctgcagctgccaatcaaatgtcacttccaaagacgacatgcaaagaca
aactctcattcttcagcactccacgtgagttataaaaccccttgtggaaggagtctacga
aacgtggaggaagtttttcgttacctgcttgagacagagtgtaactttttatttacagat
aacttttctttcaatacctatgttcagttggctcggaattacccaaagcaaaaagaagtt
gtttctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgtaatgaa
attgacagtagaaagctcccacagtttaagtacagaaagactgtgtggcctcgagcatat
aatctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggctgcata
gacataacaaaatgtgcatgtcttcaactgacagcaaggaatgccaaaacttcccccttg
tcaagtgacaaaataaccactggatataaatataaaagactacagagacagattcctact
ggcatttatgaatgcagccttttgtgcaaatgtaatcgacaattgtgtcaaaaccgagtt
gtccaacatggtcctcaagtgaggttacaggtgttcaaaactgagcagaagggatggggt
gtacgctgtctagatgacattgacagagggacatttgtttgcatttattcaggaagatta
ctaagcagagctaacactgaaaaatcttatggtattgatgaaaacgggagagatgagaat
actatgaaaaatatattttcaaaaaagaggaaattagaagttgcatgttcagattgtgaa
gttgaagttctcccattaggattggaaacacatcctagaactgctaaaactgagaaatgt
ccaccaaagttcagtaataatcccaaggagcttactgtggaaacgaaatatgataatatt
tcaagaattcaatatcattcagttattagagatcctgaatccaagacagccatttttcaa
cacaatgggaaaaaaatggaatttgtttcctcggagtctgtcactccagaagataatgat
ggatttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaaggactca
agttcaaaccatgttgatgagtttgaagataatctgctgattgaatcagatgtgatagat
ataactaaatatagagaagaaactccaccaaggagcagatgtaaccaggcgaccacattg
gataatcagaatattaaaaaggcaattgaggttcaaattcagaaaccccaagagggacga
tctacagcatgtcaaagacagcaggtattttgtgatgaagagttgctaagtgaaaccaag
aatacttcatctgattctctaacaaagttcaataaagggaatgtgtttttattggatgcc
acaaaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctcttggta
cagaatgtttttgtagaaacacacaacaggaattttccattggtggcattcttcaccaac
aggtatgtgaaagcaagaacagagctaacatgggattatggctatgaagctgggactgtg
cctgagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system