KEGG   Homo sapiens (human): 83852Help
Entry
83852             CDS       T01001                                 

Gene name
SETDB2, C13orf4, CLLD8, CLLL8, KMT1F
Definition
SET domain, bifurcated 2 (EC:2.1.1.43)
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14
AA seq 707 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKEILSLEDKVVDFR
EKDSSSNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEVVSDVDISNGVES
VPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCIDITKCACLQLTA
RNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRVVQHGPQVRLQVF
KTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDENTMKNIFSKKRKL
EVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTVETKYDNISRIQYHSVIRDP
ESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFEDNL
LIESDVIDITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGRSTACQRQQVFCD
EELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNF
PLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaaggatcctatgcctgtgactcagaaggaacaggaa
aacaaatccaatgcatttccctctacatcatgtgaaaactcctttccagaagactgtaca
tttctaacaacagaaaataaggaaattctctctcttgaagataaagttgtagactttaga
gaaaaagactcatcttcgaatttatcttaccaaagtcatgactgctctggtgcttgtctg
atgaaaatgccactgaacttgaagggagaaaaccctctgcagctgccaatcaaatgtcac
ttccaaagacgacatgcaaagacaaactctcattcttcagcactccacgtgagttataaa
accccttgtggaaggagtctacgaaacgtggaggaagtttttcgttacctgcttgagaca
gagtgtaactttttatttacagataacttttctttcaatacctatgttcagttggctcgg
aattacccaaagcaaaaagaagttgtttctgatgtggatattagcaatggagtggaatca
gtgcccatttctttctgtaatgaaattgacagtagaaagctcccacagtttaagtacaga
aagactgtgtggcctcgagcatataatctaaccaacttttccagcatgtttactgattcc
tgtgactgctctgagggctgcatagacataacaaaatgtgcatgtcttcaactgacagca
aggaatgccaaaacttcccccttgtcaagtgacaaaataaccactggatataaatataaa
agactacagagacagattcctactggcatttatgaatgcagccttttgtgcaaatgtaat
cgacaattgtgtcaaaaccgagttgtccaacatggtcctcaagtgaggttacaggtgttc
aaaactgagcagaagggatggggtgtacgctgtctagatgacattgacagagggacattt
gtttgcatttattcaggaagattactaagcagagctaacactgaaaaatcttatggtatt
gatgaaaacgggagagatgagaatactatgaaaaatatattttcaaaaaagaggaaatta
gaagttgcatgttcagattgtgaagttgaagttctcccattaggattggaaacacatcct
agaactgctaaaactgagaaatgtccaccaaagttcagtaataatcccaaggagcttact
gtggaaacgaaatatgataatatttcaagaattcaatatcattcagttattagagatcct
gaatccaagacagccatttttcaacacaatgggaaaaaaatggaatttgtttcctcggag
tctgtcactccagaagataatgatggatttaaaccaccccgagagcatctgaactctaaa
accaagggagcacaaaaggactcaagttcaaaccatgttgatgagtttgaagataatctg
ctgattgaatcagatgtgatagatataactaaatatagagaagaaactccaccaaggagc
agatgtaaccaggcgaccacattggataatcagaatattaaaaaggcaattgaggttcaa
attcagaaaccccaagagggacgatctacagcatgtcaaagacagcaggtattttgtgat
gaagagttgctaagtgaaaccaagaatacttcatctgattctctaacaaagttcaataaa
gggaatgtgtttttattggatgccacaaaagaaggaaatgtcggccgcttccttaatcat
agttgttgcccaaatctcttggtacagaatgtttttgtagaaacacacaacaggaatttt
ccattggtggcattcttcaccaacaggtatgtgaaagcaagaacagagctaacatgggat
tatggctatgaagctgggactgtgcctgagaaggaaatcttctgccaatgtggggttaat
aaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system