KEGG   Homo sapiens (human): 8386Help
Entry
8386              CDS       T01001                                 

Gene name
OR1D5, C17orf2, OR17-2, OR17-30, OR17-31, OR1D4
Definition
(RefSeq) olfactory receptor family 1 subfamily D member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    8386 (OR1D5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    8386 (OR1D5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx IBV_3C
Motif
Other DBs
NCBI-GeneID: 8386
NCBI-ProteinID: NP_055381
HGNC: 8186
Ensembl: ENSG00000262628
Vega: OTTHUMG00000177676
Pharos: P58170(Tdark)
UniProt: P58170 A0A126GVQ6
Position
17p13.3
AA seq 312 aa AA seqDB search
MDGDNQSENSQFLLLGISESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY
FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY
DRYVATCCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCD
MYILLWLACSNTHIIHTALIATGCFIFLTPLGFMTTSYVRIVRTILQMPSASKKYKTFST
CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYRLRNKDMHGAP
GRVLWRPFQRPK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatggagataaccagagtgagaactcacagttccttctcctggggatctcagagagt
cctgagcagcagcggatcctgttttggatgttcctgtccatgtacctggtcacggtgctg
ggaaatgtgctcatcatcctggccatcagctctgattcccacctgcacacccccatgtac
ttcttcctggccaacctctccttcactgacctcttctttgtcaccaacacaatccccaag
atgctggtgaacttccagtcccagaacaaagccatctcctatgcagggtgtctgacacag
ctctacttcctggtctccttggtgaccctggacaacctcatcctggccgtgatggcgtat
gatcgctatgtggccacctgctgccccctccactatgtcacagccatgagccctgggctc
tgtgtcttgctcctctccttgtgttgggggctgtctgttctctatggcctcctcctcacc
ttcctcctgaccagggtgaccttctgtgggcctcgagagatccactacctcttctgtgac
atgtacatcctgctgtggctggcatgttccaacacccacatcattcacacagcgttgatt
gccactggctgcttcatcttcctcacccccttagggttcatgaccacatcctatgtacgt
attgtcagaaccatccttcaaatgccctcggcctctaagaaatacaaaaccttctctacc
tgtgcctcccatttgggtgtggtctccctcttttatgggacgcttgctatggtgtacctg
cagcccctccatacctactccatgaaggactcagtagccacagtgatgtatgctgtgctg
acacctatgatgaaccctttcatctacaggctgaggaacaaagacatgcatggggctccg
ggaagagtcctatggagaccctttcagaggcctaaatga

DBGET integrated database retrieval system