KEGG   Homo sapiens (human): 83860Help
Entry
83860             CDS       T01001                                 

Gene name
TAF3, TAF140, TAFII-140, TAFII140
Definition
TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
Orthology
K14650  
transcription initiation factor TFIID subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    83860 (TAF3)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    83860 (TAF3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     83860 (TAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
10p15.1
AA seq 929 aa AA seqDB search
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRP
LDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIR
SPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVK
QIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIF
TSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQR
DREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDP
KVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKE
LALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKE
KEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPA
PEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASA
KAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTA
PPEEMQWFCPKCANKKKDKKHKKRKHRAH
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagagttactccaggtcgttgttgagggtctcggtggcgcagatctgccaggcg
ctgggctgggactcggtgcagctcagcgcctgccacctcctcacggacgtgctgcagcgc
tatctgcagcagctgggccggggctgccatcggtactctgagctctatggccgaacagac
ccaattttggatgatgttggtgaagctttccagctgatgggggttagtctacatgaacta
gaagactatattcacaacattgagcctgtcaccttcccacaccaaattccgtcatttcct
gttagcaagaacaatgtacttcagtttcctcaacctggaagtaaagatgcagaggaaaga
aaagaatacattcctgattacctgccacccattgtgtcttctcaagaagaagaagaagaa
gagcaggtgcccactgatggaggcacatcagcagaagccatgcaggttcccttggaagaa
gatgatgaattggaggaggaagaaattattaatgatgagaatttcctgggcaagagacca
ctggatagtcctgaagctgaagaactgccagccatgaagcggcctcggctattaagcact
aaaggggacacgctagatgttgtgttattggaagctcgagagccactcagctcaataaat
actcaaaagatcccaccaatgctttctccagtccatgtacaggacagtacagacttggca
cctccctcacccgagccgccaatgttggctccagttgcaaaatcacaaatgccaactgca
aaaccattagaaacaaagtcatttacacctaaaacaaagactaaaactagctctccagga
cagaagactaaatcacctaaaaccgcccagtcaccagcaatggtcggaagtcctattcga
tcaccaaaaactgtatccaaagaaaagaaatcacctggacgttccaagagccccaagagt
cccaagagccccaaggtcacgactcacattccccaaacacctgtgagacctgaaacgccc
aacaggactccttcagctacactcagtgaaaaaatcagtaaagagactatccaggtaaaa
caaatacagacaccccctgatgctgggaaactgaacagtgagaatcagccgaaaaaggct
gtggtagcagataaaacgattgaggcctctatcgatgctgtgattgcacgagcctgtgct
gagcgagagccagatcctttcgaattttcttctggatcggaatctgaaggagacattttt
actagccctaagagaatttcaggcccggagtgtactactcccaaagcttccacttccgcg
aacaatttcacaaagtcaggatccactcctctgcctctttccggtggaacctcaagttcc
gataactcatggacaatggatgcctccattgatgaggttgtacgtaaagcaaaactggga
acaccttcaaatatgccccccaactttccttatatctcttctccgtcagtgtctcctccc
actcccgaacctctccacaaggtgtatgaggagaaaaccaagctgccttcctccgtggag
gtaaagaagaagttgaaaaaggaactaaagactaaaatgaaaaagaaagaaaagcagaga
gatagggagagggaaaaagacaagaacaaggacaaaagtaaggagaaggataaagtgaaa
gagaaagagaaagacaaggaaactggcagggaaacaaagtatccctggaaggaatttctt
aaagaggaagaggcagatccctacaagtttaaaatcaaagaatttgaagatgttgatccc
aaagtgaaattgaaagatggacttgtgaggaaggagaaagagaagcataaagataagaag
aaagatagagagaaaggcaagaaagataaagataagagagagaaagaaaaagtgaaagat
aaaggcagagaagataagatgaaagccccagcacccccactggtgttgcccccaaaagag
ttggccctgcccttgttcagccctgccacagcctccagggtcccagccatgctgccatct
ttgttgccagtgcttccggaaaaactgtttgaggagaaagagaaggtgaaggagaaagaa
aagaaaaaggacaaaaaggagaagaagaaaaagaaggaaaaagagaaggagaagaaggag
aaggaaagagagaaagagaagagagagcgagagaagagagaaaaagagaaggagaaacac
aagcatgaaaaaataaaagtggaaccagtcgctctggccccgagtccagttatccccaga
ttaactctccgagtcggtgctggccaagacaagattgtcatcagcaaggtggtccctgcc
cccgaggccaagccggcgccctcgcagaacaggccgaagaccccaccgccggcccccgcg
cccgcccccggccccatgctcgtcagccctgcgcccgtgccgctgccgctgctcgcccag
gccgccgcgggccctgccctgctgccctccccgggtcccgccgcctccggggccagtgcc
aaagcccccgtgcgcagcgtggtgactgagacggtcagcacctacgtgatccgagatgag
tggggcaatcagatctggatctgccctgggtgtaacaagcctgacgatgggagtcccatg
attgggtgtgacgactgcgatgactggtaccactggccctgtgttggaatcatgactgca
cccccagaagagatgcagtggttctgccccaagtgtgcgaacaagaagaaggacaaaaag
cacaagaagaggaagcatcgagcccactga

DBGET integrated database retrieval system