KEGG   Homo sapiens (human): 8387Help
Entry
8387              CDS       T01001                                 

Gene name
OR1E1, HGM071, OR13-66, OR17-2, OR17-32, OR1E5, OR1E6, OR1E8P, OR1E9P, OST547
Definition
olfactory receptor, family 1, subfamily E, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    8387 (OR1E1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    8387 (OR1E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
17p13.3
AA seq 314 aa AA seqDB search
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY
LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY
DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD
MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST
CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA
LSRVIHQKKTFFSL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatgggacaaaatcaaaccagcatctcagacttcctgctcctgggcctgcccatccaa
ccagagcagcaaaacctgtgctatgccctgttcttggccatgtatcttaccaccctcctg
gggaacctcctcatcattgtcctcattcgactggactcccatctccacacgcctatgtat
ttgtttctcagcaacttgtccttctctgacctctgcttctcttccgtgaccattcccaag
ttgttacagaacatgcagaaccaggacccatccatcccctatgcggactgcctgacccaa
atgtacttcttcctgttatttggagacctggagagcttcctccttgtggccatggcctat
gaccgctatgtggccatctgcttccccctgcactacaccgccatcatgagccccatgctc
tgtctcgccctggtggcgctgtcctgggtgctgaccaccttccatgccatgttacacact
ttactcatggccaggttgtgtttttgtgcagacaatgtgatcccccactttttctgtgat
atgtctgctctgctgaagctggccttctctgacactcgagttaatgaatgggtgatattt
atcatgggagggctcattcttgtcatcccattcctactcatccttgggtcctatgcaaga
attgtctcctccatcctcaaggtcccttcttctaagggtatctgcaaggccttctctact
tgtggctcccacctgtctgtggtgtcactgttctatggaaccgttattggtctctactta
tgctcatcagctaatagttctactctaaaggacactgtcatggctatgatgtacactgtg
gtgacccccatgctgaaccccttcatctacagcctgaggaacagagacatgaagggagcc
ctgagcagagtcattcatcagaagaaaactttcttctctctctga

DBGET integrated database retrieval system