KEGG   Homo sapiens (human): 8388Help
Entry
8388              CDS       T01001                                 

Gene name
OR1E2, OR17-135, OR17-93, OR1E4, OR1E7, OST529
Definition
olfactory receptor, family 1, subfamily E, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 323 aa AA seqDB search
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY
LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY
DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD
NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS
KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS
LRNRDMKGALERVICKRKNPFLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatgggacaaaatcaaaccagcatctcagacttcctgctcctgggcctgcccatccaa
ccagagcagcaaaacctgtgctatgccctgttcttggccatgtatcttaccaccctcctg
gggaacctcctcatcattgtcctcattcgactggactcccatctccacacgcctgtgtat
ttgtttctcagcaacttgtccttctctgacctctgcttttcctcagtcacaatgcccaaa
ttgctgcagaacatgcagaaccaagacccatccatcccctatgcagactgtctgacccaa
atgtacttcttcttgtatttttcggatctagagagcttcctccttgtggccatggcctat
gaccgctatgtggccatctgcttccccatgcactacaccgccatctgcttcctcctgcac
tacaccgccatcatgagccccatgctctgtctctccgtggtggcgctgtcctgggtgctg
accaccttccatgccatgttacacactttactcatggccaggttgtgtttttgtgcagac
aatgtgatcccccactttttctgtgatatgtctgctctgctgaagctggcctgctctgac
actcgagttaatgaatgggtgatatttatcatgggagggctcattcttgtcatcccattc
ctactcatccttgggtcctatgcaagaattgtctcctccatcctcaaggtcccttcttct
aagggtatctgcaaggccttctctacttgtggctcccacctctctgtggtgtcactgttc
tatgggaccgttattggtctctacttatgcccatcagctaatagttctactctaaaggac
actgtcatggctatgatgtacactgtggtgacccctatgctgacccccttcatctacagc
ctgaggaacagagacatgaagggagccctggaaagggtcatttgtaaaaggaaaaatccc
ttccttctatga

DBGET integrated database retrieval system