KEGG   Homo sapiens (human): 83895Help
Entry
83895             CDS       T01001                                 

Gene name
KRTAP1-5, KAP1.5, KRTAP1.5
Definition
(RefSeq) keratin associated protein 1-5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BYS1(Tdark)
UniProt: 
Position
17q21.2
AA seq 174 aa AA seqDB search
MTCCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSC
CQPSCCETSCCQPSCCETSCCQPSCCQISSCGTGCGIGGGISYGQEGSSGAVSTRIRWCR
PDSRVEGTYLPPCCVVSCTPPSCCQLHHAQASCCRPSYCGQSCCRPVCCCEPTC
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacctgctgccagaccagcttctgtggatatcccagcttctccatcagtgggacctgt
ggctccagctgctgccagccaagctgctgtgagaccagctgctgccagccacgcagctgc
cagactagcttctgcggatttcccagcttctcaaccagtgggacctgcagctccagttgc
tgccagccaagctgctgtgagaccagctgctgccagccaagctgctgtgagaccagctgc
tgccagccaagctgctgccagatcagctcctgcggaactggctgtggcattggtggtggc
atcagctatggccaggagggcagcagtggagctgtgagcacccgtatcaggtggtgccgc
ccagacagtcgtgtggagggcacctacctacccccctgctgtgtggtgagctgcacgccc
ccatcctgctgccaactgcaccatgcccaggcctcctgctgccgcccgtcctactgtgga
cagtcctgctgccgcccagtctgctgctgtgagcccacttgctga

DBGET integrated database retrieval system