KEGG   Homo sapiens (human): 8390Help
Entry
8390              CDS       T01001                                 

Gene name
OR1G1, OR17-130, OR17-209, OR1G2
Definition
olfactory receptor, family 1, subfamily G, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    8390 (OR1G1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    8390 (OR1G1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 313 aa AA seqDB search
MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMY
FFLANLSLADACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAY
DCYVAICHPLHYILIMSPGLCIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCD
INPLLSLSCTDPFTNELVIFITGGLTGLICVLCLIISYTNVFSTILKIPSAQGKRKAFST
CSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSS
LRKLIWVRKIHSP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaaaaatctgaccagcatctcagaatgtttcctcctggggttctctgagcag
ctggaggagcagaagcccctctttgggtccttcctgttcatgtacttggtcacggtggca
ggcaacctcctcatcattctagtcatcattactgacactcaactccatacccccatgtac
ttctttctagccaacctctcccttgcagatgcctgctttgtgtccaccacagtccctaag
atgctggcaaacatacagatccagagtcaggccatctcctactcagggtgtctactacag
ttgtattttttcatgttatttgtgatgctggaggcattcctcttggcggtcatggcctat
gactgctacgtggccatatgccacccacttcattacattctgatcatgagccctgggctc
tgcatcttcctcgtgtctgcatcctggatcatgaatgccctccactcccttctacacaca
cttctgatgaacagcctgtccttctgcgcaaaccatgagatcccacacttcttctgtgac
atcaatcccctcctgagtctgtcctgcacagaccccttcaccaatgagctggtgatcttc
atcactgggggtctcacaggactcatttgtgtgctttgcctgattatctcttacacgaac
gttttctcgaccatcctgaagatcccatcagctcaggggaagcggaaagccttttccacc
tgcagctctcatctctccgtggtctctctcttctttgggacttctttttgtgttgatttc
agttctccctcaacccactcggcccagaaggacacagttgcatcagtgatgtacacagtg
gtaactccaatgttgaatccctttatctacagtttgaggaaccaagaaataaagtcttcc
ctgagaaagttaatctgggttcggaaaattcattccccttag

DBGET integrated database retrieval system