KEGG   Homo sapiens (human): 83903Help
Entry
83903             CDS       T01001                                 

Gene name
GSG2, HASPIN
Definition
(RefSeq) germ cell associated 2 (haspin) (EC:2.7.11.1)
  KO
K16315  
serine/threonine-protein kinase haspin [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83903 (GSG2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  Haspin family
   83903 (GSG2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    83903 (GSG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13
AA seq 798 aa AA seqDB search
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcgctcccgggacctgggagccggcttttccgcacatatggggctgcggac
ggcaggagacagcggcggccgggccgggaagccgcgcagtggttcccgccgcaggaccgg
aggcgtttcttcaacagcagcggcagcagcgacgccagcatcggcgacccctcgcagtcc
gacgatcctgacgatcccgacgaccccgacttccccggcagcccggtgaggcggcggcgg
aggcgtcccggcggccgagtgcccaaggaccggcccagcctgaccgtgaccccaaagcgc
tggaagctgcgagctcgcccaagcctaaccgtgaccccaagacgcctggggctgcgagct
cggcccccgcagaagtgcagcacaccctgcggcccgctccgacttccgcccttccccagc
cgcgactccggccgcctcagcccggacctcagcgtgtgcggccagcccagggacggcgac
gagctgggcatcagtgcctccctgttcagctctctggcctcgccctgccccgggtcccca
acgccaagggacagtgtcatctcgatcggcacctccgcctgtctggttgcagcctcagcc
gtcccgagcggcctccacctcccagaagtctccctggaccgagcatctctcccctgctcc
caggaggaagcgacaggaggagccaaggacaccaggatggtccaccaaacccgcgccagc
ctcaggtcagttctctttggccttatgaactcaggaacccctgaggattctgagtttcgg
gcagatgggaagaatatgagagagtcctgctgtaaaaggaaactggtggtgggaaatgga
ccagagggtccaggtctgtcaagcacaggcaagaggagggccacaggccaggactcttgt
caagagagagggcttcaagaggccgtccggagagagcatcaggaggccagtgttcccaag
ggccgcattgtgccaaggggaatagacaggctggagagaactagatcaagccggaagagc
aaacatcaggaggcaacggaaacctctctcctccattcccaccgctttaaaaagggccaa
aagctgggaaaagattcgttccccacccaggacctgactcctttacagaatgtctgcttt
tggaccaaaaccagggcttccttcagtttccacaagaagaaaattgtgactgatgtgtca
gaggtctgcagcatctataccactgccacttctctctctggatccctcctatcagaatgt
tcaaaccggcctgtcatgaacagaacaagtggtgctccgtcctcttggcactcctcctct
atgtatttgctaagccccttaaacactctaagtatttcaaacaaaaaggcatctgatgct
gaaaaggtttatggggaatgcagtcagaagggtcctgtcccctttagccattgccttccc
acagaaaaactgcaacgctgtgagaagattggggaaggggtgtttggcgaagtgtttcaa
acaattgctgatcacacacccgtagccataaaaatcattgctattgaaggaccagattta
gtcaatggatcccatcagaaaacctttgaggaaatcctgccagagatcatcatctccaaa
gagttgagcctcttatccggtgaagtgtgcaaccgcacagaaggctttatcgggctgaac
tcagtgcactgtgtccagggatcttaccctcccttgctcctcaaagcctgggatcactat
aattcaaccaaaggctctgcaaatgaccggcctgatttttttaaagacgaccagctcttc
attgtgctggaatttgagtttggagggattgacttagagcaaatgcgaaccaagttgtct
tccttggctactgcaaagagcattctacaccagctcacagcctccctcgcagtggcagag
gcatcactgcgctttgagcaccgagacttacactgggggaacgtgctcttaaagaaaacc
agcctcaaaaaactccactacaccctcaatgggaagagcagcactatccccagctgtggg
ttgcaagtgagcatcattgactacaccctgtcgcgcttggaacgggatgggattgtggtt
ttctgtgacgtttccatggatgaggacctgtttaccggtgacggtgactaccagtttgac
atctacaggctcatgaagaaggagaataacaaccgctggggtgaatatcacccttatagt
aatgtgctctggttacattacctgacagacaagatgctgaaacaaatgaccttcaagact
aaatgtaacactcctgccatgaagcaaattaagagaaaaatccaggagttccacaggaca
atgctgaacttcagctctgccactgacttgctctgccagcacagtctgtttaagtaa

DBGET integrated database retrieval system