KEGG   Homo sapiens (human): 8392Help
Entry
8392              CDS       T01001                                 

Gene name
OR3A3, OR17-137, OR17-16, OR17-201, OR3A6, OR3A7, OR3A8P
Definition
olfactory receptor, family 3, subfamily A, member 3
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 321 aa AA seqDB search
MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV
EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD
CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP
NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA
EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS
LRNTDVQGALCQLLVGKRSLT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtccttacagaaactcatggagccagaagctgggaccaataggaccgctgttgctgag
ttcattctactgggcctagtgcaaacagaagagatgcagccagttgtctttgtgctcctc
ctctttgcctatctggtcacaactgggggcaacctcagcatcctggcagccgtcttggtg
gagcccaaactccacgcccccatgtacttcttcctggggaacctgtcagtgctggatgtc
ggatgtatcactgtcactgttcctgcaatgttgggtcgtctcttgtcccacaagtccaca
atttcctatgacgcctgcctctcccagctcttcttcttccaccttctggctgggatggac
tgcttcctgctgaccgccatggcctatgaccgactcctggccatctgccagcccctcacc
tacagcacccgcatgagtcagacagtccagaggatgttggtggctgcgtcctgggcttgt
gccttcaccaacgcactgacccacactgtggccatgtccacgctcaacttctgtggcccc
aatgaggtcaatcacttctactgtgacctcccacagctcttccagctctcctgctccagc
acccaactcaatgagctgctgctctttgtagcagcagccttcatggctgtggcacccttg
gtcttcatcagtgtgtcctatgcccatgtggtagctgctgtgctgcaaatccgctctgct
gagggcagaaagaaggccttctccacatgtggctcccacctcactgtggtgggcatcttc
tatgggacaggtgtcttcagctacatgaggctgggttcagtggaatcttcagacaaggat
aagggggttggggttttcatgactgtgatcaaccccatgctgaacccacttatctacagc
ctcagaaatactgatgttcagggcgctctgtgtcagctacttgtggggaagcgatcactg
acctga

DBGET integrated database retrieval system