KEGG   Homo sapiens (human): 8392Help
Entry
8392              CDS       T01001                                 

Gene name
OR3A3, OR17-137, OR17-16, OR17-201, OR3A6, OR3A7, OR3A8P
Definition
(RefSeq) olfactory receptor family 3 subfamily A member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    8392 (OR3A3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    8392 (OR3A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 8392
NCBI-ProteinID: NP_036505
HGNC: 8284
Ensembl: ENSG00000159961
Vega: OTTHUMG00000090649
Pharos: P47888(Tdark)
UniProt: P47888
Position
17p13.2
AA seq 321 aa AA seqDB search
MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV
EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD
CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP
NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA
EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS
LRNTDVQGALCQLLVGKRSLT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtccttacagaaactcatggagccagaagctgggaccaataggaccgctgttgctgag
ttcattctactgggcctagtgcaaacagaagagatgcagccagttgtctttgtgctcctc
ctctttgcctatctggtcacaactgggggcaacctcagcatcctggcagccgtcttggtg
gagcccaaactccacgcccccatgtacttcttcctggggaacctgtcagtgctggatgtc
ggatgtatcactgtcactgttcctgcaatgttgggtcgtctcttgtcccacaagtccaca
atttcctatgacgcctgcctctcccagctcttcttcttccaccttctggctgggatggac
tgcttcctgctgaccgccatggcctatgaccgactcctggccatctgccagcccctcacc
tacagcacccgcatgagtcagacagtccagaggatgttggtggctgcgtcctgggcttgt
gccttcaccaacgcactgacccacactgtggccatgtccacgctcaacttctgtggcccc
aatgaggtcaatcacttctactgtgacctcccacagctcttccagctctcctgctccagc
acccaactcaatgagctgctgctctttgtagcagcagccttcatggctgtggcacccttg
gtcttcatcagtgtgtcctatgcccatgtggtagctgctgtgctgcaaatccgctctgct
gagggcagaaagaaggccttctccacatgtggctcccacctcactgtggtgggcatcttc
tatgggacaggtgtcttcagctacatgaggctgggttcagtggaatcttcagacaaggat
aagggggttggggttttcatgactgtgatcaaccccatgctgaacccacttatctacagc
ctcagaaatactgatgttcagggcgctctgtgtcagctacttgtggggaagcgatcactg
acctga

DBGET integrated database retrieval system