KEGG   Homo sapiens (human): 83931Help
Entry
83931             CDS       T01001                                 

Gene name
STK40, SHIK, SgK495
Definition
(RefSeq) serine/threonine kinase 40 (EC:2.7.11.1)
  KO
K16312  
serine/threonine-protein kinase 40 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83931 (STK40)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  Other families
   83931 (STK40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.3
AA seq 435 aa AA seqDB search
MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTD
DFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEI
VEDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADLINLQHYVIKEKRLSERETVVIFYD
VVRVVEALHQKNIVHRDLKLGNMVLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYI
SPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVS
ENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPDIDDQMSNADS
SQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPM
TSLDTAILAQRYLRK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggagagcatcagacagaggagctggggaaacgtcggccagggccaaggctcta
ggaagtgggatttctggaaataatgcaaagagagctggaccattcatccttggtccccgt
ctgggcaactcaccggtgccaagcatagtgcagtgtttggcgaggaaagatggcacggat
gacttctatcagctgaagatcctgaccctggaggagaggggggaccaaggcatagagagc
caggaagagcggcagggcaagatgctgctgcacaccgagtactcactgctgtctctcctg
cacacgcaggatggcgtggtgcaccaccacggcctcttccaggaccgcacctgtgaaatc
gttgaggacacagaatccagccggatggttaagaagatgaagaagcgcatctgcctcgtc
ctggactgcctctgtgctcatgacttcagcgataagaccgctgacctcatcaacctgcag
cactacgtcatcaaggagaagaggctcagcgagagggagactgtggtaatcttctacgac
gtggtccgcgtggtggaggccctgcaccagaaaaatatcgtgcacagagacctgaagctg
gggaacatggtgctcaacaagaggacacatcggataaccatcaccaacttctgcctcggg
aagcatctggtgagcgagggggacctgctgaaggaccagagagggagccctgcctacatc
agtcccgacgtgctcagcggccggccgtaccgtggcaagcccagtgacatgtgggccctg
ggcgtggtgctcttcaccatgctgtatggccagttccccttctacgacagcatcccgcag
gagctcttccgcaagatcaaggctgccgagtataccattcctgaggatggacgggtttct
gagaacaccgtgtgtctcatccggaagctgctggtccttgacccccagcagcgcctggcc
gccgccgacgtcctggaggccctcagtgccatcattgcatcatggcagtccctgtcatct
ctgagtgggcctttgcaagtggttcctgacattgatgaccaaatgagcaatgcggatagc
tcccaggaggcgaaggtgacggaggagtgctcccagtacgagtttgagaactacatgcgt
cagcagctgctgctggccgaggagaagagctccatccatgacgcccggagctgggtaccc
aagcggcagttcggcagcgcaccaccggtgcgacggctgggccacgacgcacagcccatg
acctccttggacacggccatcctggcgcagcgctacctgcggaaataa

DBGET integrated database retrieval system