KEGG   Homo sapiens (human): 83938Help
Entry
83938             CDS       T01001                                 

Gene name
C10orf11, OCA5, OCA7
Definition
chromosome 10 open reading frame 11
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.3
AA seq 198 aa AA seqDB search
MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRIT
DLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDA
QKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRY
VYYGKNSEGNRFIRDDQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatttgtcactcagcggcaatcattcttcaaataaaaggtcactggaagga
ctgagcgcattcaggagcctggaggaactcatcttggacaacaatcagctgggggacgac
cttgtgttgccagggttacccagactgcataccttaaccctcaacaagaaccgaatcact
gatttggagaacctgctggatcacttggcagaagtgacaccagctctggagtacctcagt
ctgctgggcaacgtggcctgtcccaacgagctggtcagcttggaaaaggatgaggaagac
tacaagagatacagatgctttgttctgtacaagctgcccaacttgaaatttctggatgcc
cagaaagtaaccagacaagaacgagaggaggcgttggtcagaggagtcttcatgaaggtg
gtgaagcccaaggcttctagtgaggacgttgccagctccccggagcgccactacacgccc
ttgccttctgcttccagggaactcaccagtcaccaaggtgtcctggggaagtgtcgctac
gtttactatgggaaaaactcagagggcaacaggtttatccgagatgaccagctctga

DBGET integrated database retrieval system