KEGG   Homo sapiens (human): 83938Help
Entry
83938             CDS       T01001                                 

Gene name
C10orf11, OCA5, OCA7
Definition
chromosome 10 open reading frame 11
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.3
AA seq 198 aa AA seqDB search
MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRIT
DLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDA
QKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRY
VYYGKNSEGNRFIRDDQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatttgtcactcagcggcaatcattcttcaaataaaaggtcactggaagga
ctgagcgcattcaggagcctggaggaactcatcttggacaacaatcagctgggggacgac
cttgtgttgccagggttacccagactgcataccttaaccctcaacaagaaccgaatcact
gatttggagaacctgctggatcacttggcagaagtgacaccagctctggagtacctcagt
ctgctgggcaacgtggcctgtcccaacgagctggtcagcttggaaaaggatgaggaagac
tacaagagatacagatgctttgttctgtacaagctgcccaacttgaaatttctggatgcc
cagaaagtaaccagacaagaacgagaggaggcgttggtcagaggagtcttcatgaaggtg
gtgaagcccaaggcttctagtgaggacgttgccagctccccggagcgccactacacgccc
ttgccttctgcttccagggaactcaccagtcaccaaggtgtcctggggaagtgtcgctac
gtttactatgggaaaaactcagagggcaacaggtttatccgagatgaccagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system