KEGG   Homo sapiens (human): 8394Help
Entry
8394              CDS       T01001                                 

Gene name
PIP5K1A
Definition
phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (EC:2.7.1.68)
Orthology
K00889  
1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 522 aa AA seqDB search
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVPYASGMPIKKIGHRSVDSS
GETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAH
HYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFI
IKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSV
KMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDC
LVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEAR
RGGTMETDDQFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPS
KKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLE
EISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEFTH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccgtcgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtaccttgtcctcagcagcatctggaatcaagagacccatggcatctgag
gtgccttatgcctctggcatgcccatcaagaaaataggccatagaagtgttgattcctca
ggagagacaacatataaaaagacaacctcatcagccttgaaaggtgccatccagttaggc
attacccacactgtggggagcctgagtaccaaaccagagcgtgatgtcctcatgcaagat
ttctacgtggttgagagtatcttctttcccagtgaagggagcaacctgacccctgctcat
cactacaatgactttcgtttcaagacctatgcacctgttgccttccgctacttccgggag
ctatttggtatccggcccgatgattacttgtattccctctgcagtgagccgctgattgaa
ctctgtagctctggagctagtggttccctattctatgtgtccagcgacgatgagttcatt
attaagacagtccaacataaagaggcggaatttctgcagaagctgcttccaggatactac
atgaacctcaaccagaaccctcggactttgctgcctaaattctatggactgtactgtgtg
caggcaggtggcaagaacattcggattgtggtgatgaacaatcttttaccaagatcggta
aaaatgcatatcaaatatgacctcaaaggctcaacctacaaacggcgggcttcccagaaa
gagcgagagaagcctcttcccacatttaaagacctagacttcttacaagacatccctgat
ggtctttttttggatgctgacatgtacaacgctctctgtaagaccctgcagcgtgactgt
ttggtgctgcagagcttcaagataatggattacagcctcttgatgtcaatccataatata
gatcatgcacaacgagagcccttaagcagtgaaacacagtactcagttgatactcgaaga
ccggccccccaaaaggctctgtattccacagccatggaatccatccagggagaggctcga
cggggtggtaccatggagactgatgaccagtttgttaagaagttggagcactcttggaaa
gccctggtacatgacggagacactgtctcagtgcatcgcccaggcttctacgctgaacgg
ttccagcgcttcatgtgcaacacagtatttaagaagattcccttgaagccttctccttcc
aaaaagtttcggtctggctcatctttctctcggcgagcaggctccagtggcaactcctgc
attacttaccagccatcggtctctggggaacacaaggcacaagtgacaacaaaggcagaa
gtggagccaggcgttcaccttggtcgtcctgatgttttacctcagactccacctttggag
gaaatcagtgagggctcgcctattcctgaccccagtttctcacctctagttggagagact
ttgcaaatgctaactacaagtacaaccttggaaaagcttgaagttgcagagtcagagttc
acccattaa

DBGET integrated database retrieval system