KEGG   Homo sapiens (human): 8394Help
Entry
8394              CDS       T01001                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 alpha (EC:2.7.1.68)
  KO
K00889  
1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Choline metabolism in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8394 (PIP5K1A)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8394 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    8394 (PIP5K1A)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8394 (PIP5K1A)
  Cell motility
   04810 Regulation of actin cytoskeleton
    8394 (PIP5K1A)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8394 (PIP5K1A)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    8394 (PIP5K1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8394 (PIP5K1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 562 aa AA seqDB search
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMP
IKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIF
FPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASG
SLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIR
IVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADM
YNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
STAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSC
ITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGET
LQMLTTSTTLEKLEVAESEFTH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccgtcgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtaccttgtcctcagcagcatctggaatcaagagacccatggcatctgag
gtcttggaagctagacaggattcttacatctcattggtgccttatgcctctggcatgccc
atcaagaaaataggccatagaagtgttgattcctcaggagagacaacatataaaaagaca
acctcatcagccttgaaaggtgccatccagttaggcattacccacactgtggggagcctg
agtaccaaaccagagcgtgatgtcctcatgcaagatttctacgtggttgagagtatcttc
tttcccagtgaagggagcaacctgacccctgctcatcactacaatgactttcgtttcaag
acctatgcacctgttgccttccgctacttccgggagctatttggtatccggcccgatgat
tacttgtattccctctgcagtgagccgctgattgaactctgtagctctggagctagtggt
tccctattctatgtgtccagcgacgatgagttcattattaagacagtccaacataaagag
gcggaatttctgcagaagctgcttccaggatactacatgaacctcaaccagaaccctcgg
actttgctgcctaaattctatggactgtactgtgtgcaggcaggtggcaagaacattcgg
attgtggtgatgaacaatcttttaccaagatcggtaaaaatgcatatcaaatatgacctc
aaaggctcaacctacaaacggcgggcttcccagaaagagcgagagaagcctcttcccaca
tttaaagacctagacttcttacaagacatccctgatggtctttttttggatgctgacatg
tacaacgctctctgtaagaccctgcagcgtgactgtttggtgctgcagagcttcaagata
atggattacagcctcttgatgtcaatccataatatagatcatgcacaacgagagccctta
agcagtgaaacacagtactcagttgatactcgaagaccggccccccaaaaggctctgtat
tccacagccatggaatccatccagggagaggctcgacggggtggtaccatggagactgat
gaccatatgggtggcatccctgcccggaatagtaaaggggaaaggcttctgctttatatt
ggcatcattgacattctacagtcttacaggtttgttaagaagttggagcactcttggaaa
gccctggtacatgacggagacactgtctcagtgcatcgcccaggcttctacgctgaacgg
ttccagcgcttcatgtgcaacacagtatttaagaagattcccttgaagccttctccttcc
aaaaagtttcggtctggctcatctttctctcggcgagcaggctccagtggcaactcctgc
attacttaccagccatcggtctctggggaacacaaggcacaagtgacaacaaaggcagaa
gtggagccaggcgttcaccttggtcgtcctgatgttttacctcagactccacctttggag
gaaatcagtgagggctcgcctattcctgaccccagtttctcacctctagttggagagact
ttgcaaatgctaactacaagtacaaccttggaaaagcttgaagttgcagagtcagagttc
acccattaa

DBGET integrated database retrieval system