KEGG   Homo sapiens (human): 83942Help
Entry
83942             CDS       T01001                                 

Gene name
TSSK1B, FKSG81, SPOGA4, STK22D, TSK1, TSSK1
Definition
(RefSeq) testis specific serine kinase 1B (EC:2.7.11.1)
  KO
K08811  
testis-specific serine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83942 (TSSK1B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  TSSK family
   83942 (TSSK1B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    83942 (TSSK1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q22.2
AA seq 367 aa AA seqDB search
MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPRE
IEILAMLNHCSIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQL
SLAIKYCHDLDVVHRDLKCDNLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPA
YAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKH
LTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSPSVAINKEGESSRGTEPLWTP
EPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQ
PPETRAQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgctgctgtcctcaagcgacgaggctacctcctggggataaatttaggagag
ggctcctatgcaaaagtaaaatctgcttactctgagcgcctgaagttcaatgtggcgatc
aagatcatcgaccgcaagaaggcccccgcagacttcttggagaaattccttccccgggaa
attgagattctggccatgttaaaccactgctccatcattaagacctacgagatctttgag
acatcacatggcaaggtctacatcgtcatggagctcgcggtccagggcgacctcctcgag
ttaatcaaaacccggggagccctgcatgaggacgaagctcgcaagaagttccaccagctt
tccttggccatcaagtactgccacgacctggacgtcgtccaccgggacctcaagtgtgac
aaccttctccttgacaaggacttcaacatcaagctgtccgacttcagcttctccaagcgc
tgcctgcgggatgacagtggtcgaatggcattaagcaagaccttctgtgggtcaccagcg
tatgcggccccagaggtgctgcagggcattccctaccagcccaaggtgtacgacatctgg
agcctaggcgtgatcctctacatcatggtctgcggctccatgccctacgacgactccaac
atcaagaagatgctgcgtatccagaaggagcaccgcgtcaacttcccacgctccaagcac
ctgacaggcgagtgcaaggacctcatctaccacatgctgcagcccgacgtcaaccggcgg
ctccacatcgacgagatcctcagccactgctggatgcagcccaaggcacggggatctccc
tctgtggccatcaacaaggagggggagagttcccggggaactgaacccttgtggaccccc
gaacctggctctgacaagaagtctgccaccaagctggagcctgagggagaggcacagccc
caggcacagcctgagacaaaacccgaggggacagcaatgcaaatgtccaggcagtcggag
atcctgggtttccccagcaagccgtcgactatggagacagaggaagggcccccccaacag
cctccagagacgcgggcccagtga

DBGET integrated database retrieval system