KEGG   Homo sapiens (human): 83943Help
Entry
83943             CDS       T01001                                 

Gene name
IMMP2L, IMMP2L-IT1, IMP2, IMP2-LIKE
Definition
IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)
Orthology
K09648  
mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31
AA seq 175 aa AA seqDB search
MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL
LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV
EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtcacaagggtgggtgaaaagatacatcaaggccttttgtaaaggcttcttt
gtggcggtgcctgtggcagtgactttcttggatcgggtcgcctgtgtggcaagagtagaa
ggagcatcgatgcagccttctttgaatcctggggggagccagtcatctgatgtggtgctt
ttgaaccactggaaagtgaggaattttgaagtacaccgtggtgacattgtatcattggtg
tctcctaaaaacccagaacagaagatcattaagagagtgattgctcttgaaggagatatt
gtcagaaccataggacacaaaaaccggtatgtcaaagtcccccgtggtcacatctgggtt
gaaggtgatcatcatggacacagttttgacagtaattcttttgggccggtttccctagga
cttctgcatgcccatgccacacatatcctgtggcccccagagcgctggcagaaattggaa
tctgttcttcctccagagcgcttaccagtacagagagaagaggaatga

DBGET integrated database retrieval system