KEGG   Homo sapiens (human): 83943Help
Entry
83943             CDS       T01001                                 

Gene name
IMMP2L, IMMP2L-IT1, IMP2, IMP2-LIKE
Definition
IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)
Orthology
K09648  
mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    83943 (IMMP2L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     83943 (IMMP2L)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   83943 (IMMP2L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    83943 (IMMP2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31
AA seq 175 aa AA seqDB search
MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL
LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV
EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtcacaagggtgggtgaaaagatacatcaaggccttttgtaaaggcttcttt
gtggcggtgcctgtggcagtgactttcttggatcgggtcgcctgtgtggcaagagtagaa
ggagcatcgatgcagccttctttgaatcctggggggagccagtcatctgatgtggtgctt
ttgaaccactggaaagtgaggaattttgaagtacaccgtggtgacattgtatcattggtg
tctcctaaaaacccagaacagaagatcattaagagagtgattgctcttgaaggagatatt
gtcagaaccataggacacaaaaaccggtatgtcaaagtcccccgtggtcacatctgggtt
gaaggtgatcatcatggacacagttttgacagtaattcttttgggccggtttccctagga
cttctgcatgcccatgccacacatatcctgtggcccccagagcgctggcagaaattggaa
tctgttcttcctccagagcgcttaccagtacagagagaagaggaatga

DBGET integrated database retrieval system