KEGG   Homo sapiens (human): 8395Help
Entry
8395              CDS       T01001                                 

Gene name
PIP5K1B, MSS4, STM7
Definition
phosphatidylinositol-4-phosphate 5-kinase, type I, beta (EC:2.7.1.68)
Orthology
K00889  
1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Choline metabolism in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8395 (PIP5K1B)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8395 (PIP5K1B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8395 (PIP5K1B)
  Cell motility
   04810 Regulation of actin cytoskeleton
    8395 (PIP5K1B)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8395 (PIP5K1B)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    8395 (PIP5K1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8395 (PIP5K1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q13
AA seq 502 aa AA seqDB search
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgctgctgaaaatggagaggcagcacctggaaaacaaaatgaagaaaaaacc
tataaaaagactgcatcatctgctattaaaggtgctattcagctgggaataggatacaca
gtgggtaatctcacttccaagccagaacgagatgttcttatgcaagacttttatgtggtg
gaaagtgtgttcctacccagcgaagggagcaatctgaccccagcacatcactacccagac
tttagatttaagacatacgctccattagcattccgatatttcagagaactttttggtatc
aagcctgatgattacttgtattccatctgcagtgaacctctaatagaactgtctaaccct
ggagccagtggatccttgttttttgtgaccagtgatgatgaatttatcatcaaaacagtt
cagcacaaagaagctgagtttcttcagaagctactgccaggctattacatgaatttaaac
cagaatccaaggactcttttgccaaaattttacggactgtattgtatgcaatcaggaggc
attaatatcaggattgtggtgatgaacaacgttttgccacgctccatgagaatgcacttt
acatatgacttgaaaggctcaacgtataagcgaagagcatcccgtaaagagagagagaaa
tccaaccccacatttaaggacttagatttcctgcaagacatgcacgaagggttgtatttt
gatacggaaacatacaacgcgcttatgaaaacacttcagagagactgccgggtgctagaa
agcttcaagatcatggattatagccttctgttgggaattcatttcctggaccattccctc
aaagagaaagaggaggagaccccacaaaatgtgcctgatgctaagcggactgggatgcag
aaggttctctactcaacagccatggaatctatccagggtccagggaaatctggagatggg
ataatcacagagaacccagacacaatgggaggcattccagctaaaagccataggggagaa
aaactacttttatttatgggcattattgacattctgcaatcatataggttaatgaagaag
ttagaacattcctggaaagctcttgtttatgatggggacactgtttctgttcatagacca
agcttttatgcagacagatttcttaagttcatgaattccagagttttcaagaaaattcaa
gctttgaaggcttcaccgtctaagaaacggtgcaattcaatcgccgccctaaaggccact
tcacaggagattgtgtcctcaattagccaggaatggaaggatgagaagcgggatttgctg
actgaaggacaaagttttagcagccttgatgaagaagccctgggatcccgacacaggcca
gacctggtccctagcactccatcactgtttgaagctgcttccttggcaaccacaatttca
tcttcttccttatacgtcaatgagcactatccacacgacaggcctacactctattcaaac
agtaagtga

DBGET integrated database retrieval system