KEGG   Homo sapiens (human): 8396Help
Entry
8396              CDS       T01001                                 

Gene name
PIP4K2B, PI5P4KB, PIP5K2B, PIP5KIIB, PIP5KIIbeta
Definition
phosphatidylinositol-5-phosphate 4-kinase, type II, beta (EC:2.7.1.149)
Orthology
K00920  
1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Regulation of actin cytoskeleton
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 416 aa AA seqDB search
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaactgcaccagcaccacggcggtggcggtggcgccgctcagcgccagcaag
accaagaccaagaagaagcatttcgtgtgccagaaagtgaagctattccgggccagcgag
ccgatcctcagcgtcctgatgtggggggtgaaccacacgatcaatgagctgagcaatgtt
cctgttcctgtcatgctaatgccagatgacttcaaagcctacagcaagatcaaggtggac
aatcatctcttcaataaggagaacctgcccagccgctttaagtttaaggagtattgcccc
atggtgttccgaaaccttcgggagaggtttggaattgatgatcaggattaccagaattca
gtgacgcgcagcgcccccatcaacagtgacagccagggtcggtgtggcacgcgtttcctc
accacctacgaccggcgctttgtcatcaagactgtgtccagcgaggacgtggcggagatg
cacaacatcttaaagaaataccaccagtttatagtggagtgtcatggcaacacgcttttg
ccacagttcctgggcatgtaccgcctgaccgtggatggtgtggaaacctacatggtggtt
accaggaacgtgttcagccatcggctcactgtgcatcgcaagtatgacctcaagggttct
acggttgccagagaagcgagcgacaaggagaaggccaaggacttgccaacattcaaagac
aatgacttcctcaatgaagggcagaagctgcatgtgggagaggagagtaaaaagaacttc
ctggagaaactgaagcgggacgttgagttcttggcacagctgaagatcatggactacagc
ctgctggtgggcatccacgacgtggaccgggcagagcaggaggagatggaggtggaggag
cgggcagaggacgaggagtgtgagaatgatggggtgggtggcaacctactctgctcctat
ggcacacctccggacagccctggcaacctcctcagctttcctcggttctttggtcctggg
gaattcgacccctctgttgacgtctatgccatgaaaagccatgaaagttcccccaagaag
gaggtgtatttcatggccatcattgatatcctcacgccatacgatacaaagaagaaagct
gcacatgctgccaaaacggtgaaacacggggcaggggccgagatctcgactgtgaaccct
gagcagtactccaaacgcttcaacgagtttatgtccaacatcctgacgtag

DBGET integrated database retrieval system