KEGG   Homo sapiens (human): 840Help
Entry
840               CDS       T01001                                 

Gene name
CASP7, CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Definition
(RefSeq) caspase 7 (EC:3.4.22.60)
  KO
K04397  
caspase 7 [EC:3.4.22.60]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Apoptosis - multiple species
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Pertussis
Legionellosis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    840 (CASP7)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    840 (CASP7)
   04215 Apoptosis - multiple species
    840 (CASP7)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    840 (CASP7)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    840 (CASP7)
  Infectious diseases
   05133 Pertussis
    840 (CASP7)
   05134 Legionellosis
    840 (CASP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     840 (CASP7)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   840 (CASP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q25
AA seq 303 aa AA seqDB search
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagat
tcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaag
aaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtac
aacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaa
gtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgc
ttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaa
gatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatc
ctcttaagccatggagaagaaaatgtaatttatgggaaagatggtgtcacaccaataaag
gatttgacagcccactttaggggggatagatgcaaaacccttttagagaaacccaaactc
ttcttcattcaggcttgccgagggaccgagcttgatgatggcatccaggccgactcgggg
cccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctc
ttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctgg
tttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcag
atcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgaccca
cacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctac
ttcagtcaatag

DBGET integrated database retrieval system