KEGG   Homo sapiens (human): 840Help
Entry
840               CDS       T01001                                 

Gene name
CASP7, CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Definition
caspase 7, apoptosis-related cysteine peptidase (EC:3.4.22.60)
Orthology
K04397  
caspase 7 [EC:3.4.22.60]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Pertussis
Legionellosis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    840 (CASP7)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    840 (CASP7)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    840 (CASP7)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    840 (CASP7)
  Infectious diseases
   05133 Pertussis
    840 (CASP7)
   05134 Legionellosis
    840 (CASP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     840 (CASP7)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   840 (CASP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q25
AA seq 303 aa AA seqDB search
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagat
tcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaag
aaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtac
aacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaa
gtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgc
ttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaa
gatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatc
ctcttaagccatggagaagaaaatgtaatttatgggaaagatggtgtcacaccaataaag
gatttgacagcccactttaggggggatagatgcaaaacccttttagagaaacccaaactc
ttcttcattcaggcttgccgagggaccgagcttgatgatggcatccaggccgactcgggg
cccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctc
ttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctgg
tttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcag
atcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgaccca
cacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctac
ttcagtcaatag

DBGET integrated database retrieval system