KEGG   Homo sapiens (human): 84002Help
Entry
84002             CDS       T01001                                 

Gene name
B3GNT5, B3GN-T5, beta3Gn-T5
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 (EC:2.4.1.206)
Orthology
K03766  
beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q28
AA seq 378 aa AA seqDB search
MRMLVSGRRVKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRYLINSYDFVND
TLSLKHTSAGPRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQ
LNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWAN
TYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVS
YEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDH
VFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKVKTISKGFFGQIYCRLMKII
LLCKISYVDTYPCRAAFI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgttggttagtggcagaagagtcaaaaaatggcagttaattattcagttattt
gctacttgttttttagcgagcctcatgtttttttgggaaccaatcgataatcacattgtg
agccatatgaagtcatattcttacagatacctcataaatagctatgactttgtgaatgat
accctgtctcttaagcacacctcagcggggcctcgctaccaatacttgattaaccacaag
gaaaagtgtcaagctcaagacgtcctccttttactgtttgtaaaaactgctcctgaaaac
tatgatcgacgttccggaattagaaggacgtggggcaatgaaaattatgttcggtctcag
ctgaatgccaacatcaaaactctgtttgccttaggaactcctaatccactggagggagaa
gaactacaaagaaaactggcttgggaagatcaaaggtacaatgatataattcagcaagac
tttgttgattctttctacaatcttactctgaaattacttatgcagttcagttgggcaaat
acctattgtccacatgccaaatttcttatgactgctgatgatgacatatttattcacatg
ccaaatctgattgagtaccttcaaagtttagaacaaattggtgttcaagacttttggatt
ggtcgtgttcatcgtggtgcccctcccattagagataaaagcagcaaatactacgtgtcc
tatgaaatgtaccagtggccagcttaccctgactacacagccggagctgcctatgtaatc
tccggtgatgtagctgccaaagtctatgaggcatcacagacactaaattcaagtctttac
atagacgatgtgttcatgggcctctgtgccaataaaatagggatagtaccgcaggaccat
gtgtttttttctggagagggtaaaactccttatcatccctgcatctatgaaaaaatgatg
acatctcatggacacttagaagatctccaggacctttggaagaatgctacagatcctaaa
gtaaaaaccatttccaaaggtttttttggtcaaatatactgcagattaatgaagataatt
ctcctttgtaaaattagctatgtggacacatacccttgtagggctgcgtttatctaa

DBGET integrated database retrieval system