KEGG   Homo sapiens (human): 84059Help
Entry
84059             CDS       T01001                                 

Gene name
ADGRV1, FEB4, GPR98, MASS1, USH2B, USH2C, VLGR1, VLGR1b
Definition
(RefSeq) adhesion G protein-coupled receptor V1
  KO
K18263  
G-protein coupled receptor 98
Organism
hsa  Homo sapiens (human)
Disease
H00779  
Usher syndrome (US)
H00783  
Febrile seizures
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84059 (ADGRV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q13
AA seq 6306 aa AA seqDB search
MSVFLGPGMPSASLLVNLLSALLILFVFGETEIRFTGQTEFVVNETSTTVIRLIIERIGE
PANVTAIVSLYGEDAGDFFDTYAAAFIPAGETNRTVYIAVCDDDLPEPDETFIFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGIISFNMLPSIAVSEPKGRNESMPLTLIREKGTYGM
VMVTFEVEGGPNPPDEDLSPVKGNITFPPGRATVIYNLTVLDDEVPENDEIFLIQLKSVE
GGAEINTSRNSIEIIIKKNDSPVRFLQSIYLVPEEDHILIIPVVRGKDNNGNLIGSDEYE
VSISYAVTTGNSTAHAQQNLDFIDLQPNTTVVFPPFIHESHLKFQIVDDTIPEIAESFHI
MLLKDTLQGDAVLISPSVVQVTIKPNDKPYGVLSFNSVLFERTVIIDEDRISRYEEITVV
RNGGTHGNVSANWVLTRNSTDPSPVTADIRPSSGVLHFAQGQMLATIPLTVVDDDLPEEA
EAYLLQILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPMENQKIESSPGERYLSLS
FTRLGGTKGDVRLLYSVLYIPAGAVDPLQAKEGILNISRRNDLIFPEQKTQVTTKLPIRN
DAFLQNGAHFLVQLETVELLNIIPLIPPISPRFGEICNISLLVTPAIANGEIGFLSNLPI
ILHEPEDFAAEVVYIPLHRDGTDGQATVYWSLKPSGFNSKAVTPDDIGPFNGSVLFLSGQ
SDTTINITIKGDDIPEMNETVTLSLDRVNVENQVLKSGYTSRDLIILENDDPGGVFEFSP
ASRGPYVIKEGESVELHIIRSRGSLVKQFLHYRVEPRDSNEFYGNTGVLEFKPGEREIVI
TLLARLDGIPELDEHYWVVLSSHGERESKLGSATIVNITILKNDDPHGIIEFVSDGLIVM
INESKGDAIYSAVYDVVRNRGNFGDVSVSWVVSPDFTQDVFPVQGTVVFGDQEFSKNITI
YSLPDEIPEEMEEFTVILLNGTGGAKVGNRTTATLRIRRNDDPIYFAEPRVVRVQEGETA
NFTVLRNGSVDVTCMVQYATKDGKATARERDFIPVEKGETLIFEVGSRQQSISIFVNEDG
IPETDEPFYIILLNSTGDTVVYQYGVATVIIEANDDPNGIFSLEPIDKAVEEGKTNAFWI
LRHRGYFGSVSVSWQLFQNDSALQPGQEFYETSGTVNFMDGEEAKPIILHAFPDKIPEFN
EFYFLKLVNISGGSPGPGGQLAETNLQVTVMVPFNDDPFGVFILDPECLEREVAEDVLSE
DDMSYITNFTILRQQGVFGDVQLGWEILSSEFPAGLPPMIDFLLVGIFPTTVHLQQHMRR
HHSGTDALYFTGLEGAFGTVNPKYHPSRNNTIANFTFSAWVMPNANTNGFIIAKDDGNGS
IYYGVKIQTNESHVTLSLHYKTLGSNATYIAKTTVMKYLEESVWLHLLIILEDGIIEFYL
DGNAMPRGIKSLKGEAITDGPGILRIGAGINGNDRFTGLMQDVRSYERKLTLEEIYELHA
MPAKSDLHPISGYLEFRQGETNKSFIISARDDNDEEGEELFILKLVSVYGGARISEENTT
ARLTIQKSDNANGLFGFTGACIPEIAEEGSTISCVVERTRGALDYVHVFYTISQIETDGI
NYLVDDFANASGTITFLPWQRSEVLNIYVLDDDIPELNEYFRVTLVSAIPGDGKLGSTPT
SGASIDPEKETTDITIKASDHPYGLLQFSTGLPPQPKDAMTLPASSVPHITVEEEDGEIR
LLVIRAQGLLGRVTAEFRTVSLTAFSPEDYQNVAGTLEFQPGERYKYIFINITDNSIPEL
EKSFKVELLNLEGGVAELFRVDGSGSGDGDMEFFLPTIHKRASLGVASQILVTIAASDHA
HGVFEFSPESLFVSGTEPEDGYSTVTLNVIRHHGTLSPVTLHWNIDSDPDGDLAFTSGNI
TFEIGQTSANITVEILPDEDPELDKAFSVSVLSVSSGSLGAHINATLTVLASDDPYGIFI
FSEKNRPVKVEEATQNITLSIIRLKGLMGKVLVSYATLDDMEKPPYFPPNLARATQGRDY
IPASGFALFGANQSEATIAISILDDDEPERSESVFIELLNSTLVAKVQSRSIPNSPRLGP
KVETIAQLIIIANDDAFGTLQLSAPIVRVAENHVGPIINVTRTGGAFADVSVKFKAVPIT
AIAGEDYSIASSDVVLLEGETSKAVPIYVINDIYPELEESFLVQLMNETTGGARLGALTE
AVIIIEASDDPYGLFGFQITKLIVEEPEFNSVKVNLPIIRNSGTLGNVTVQWVATINGQL
ATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTIGLDRIANI
IIPANDDPYGTVAFAQMVYRVQEPLERSSCANITVRRSGGHFGRLLLFYSTSDIDVVALA
MEEGQDLLSYYESPIQGVPDPLWRTWMNVSAVGEPLYTCATLCLKEQACSAFSFFSASEG
PQCFWMTSWISPAVNNSDFWTYRKNMTRVASLFSGQAVAGSDYEPVTRQWAIMQEGDEFA
NLTVSILPDDFPEMDESFLISLLEVHLMNISASLKNQPTIGQPNISTVVIALNGDAFGVF
VIYNISPNTSEDGLFVEVQEQPQTLVELMIHRTGGSLGQVAVEWRVVGGTATEGLDFIGA
GEILTFAEGETKKTVILTILDDSEPEDDESIIVSLVYTEGGSRILPSSDTVRVNILANDN
VAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFF
PEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAAVLTVEASD
EPHGVLNFALSSRFVLLQEANITIQLFINREFGSLGAINVTYTTVPGMLSLKNQTVGNLA
EPEVDFVPIIGFLILEEGETAAAINITILEDDVPELEEYFLVNLTYVGLTMAASTSFPPR
LDSEGLTAQVIIDANDGARGVIEWQQSRFEVNETHGSLTLVAQRSREPLGHVSLFVYAQN
LEAQVGLDYIFTPMILHFADGERYKNVNIMILDDDIPEGDEKFQLILTNPSPGLELGKNT
IALIIVLANDDGPGVLSFNNSEHFFLREPTALYVQESVAVLYIVREPAQGLFGTVTVQFI
VTEVNSSNESKDLTPSKGYIVLEEGVRFKALQISAILDTEPEMDEYFVCTLFNPTGGARL
GVHVQTLITVLQNQAPLGLFSISAVENRATSIDIEEANRTVYLNVSRTNGIDLAVSVQWE
TVSETAFGMRGMDVVFSVFQSFLDESASGWCFFTLENLIYGIMLRKSSVTVYRWQGIFIP
VEDLNIENPKTCEAFNIGFSPYFVITHEERNEEKPSLNSVFTFTSGFKLFLVQTIIILES
SQVRYFTSDSQDYLIIASQRDDSELTQVFRWNGGSFVLHQKLPVRGVLTVALFNKGGSVF
LAISQANARLNSLLFRWSGSGFINFQEVPVSGTTEVEALSSANDIYLIFAENVFLGDQNS
IDIFIWEMGQSSFRYFQSVDFAAVNRIHSFTPASGIAHILLIGQDMSALYCWNSERNQFS
FVLEVPSAYDVASVTVKSLNSSKNLIALVGAHSHIYELAYISSHSDFIPSSGELIFEPGE
REATIAVNILDDTVPEKEESFKVQLKNPKGGAEIGINDSVTITILSNDDAYGIVAFAQNS
LYKQVEEMEQDSLVTLNVERLKGTYGRITIAWEADGSISDIFPTSGVILFTEGQVLSTIT
LTILADNIPELSEVVIVTLTRITTEGVEDSYKGATIDQDRSKSVITTLPNDSPFGLVGWR
AASVFIRVAEPKENTTTLQLQIARDKGLLGDIAIHLRAQPNFLLHVDNQATENEDYVLQE
TIIIMKENIKEAHAEVSILPDDLPELEEGFIVTITEVNLVNSDFSTGQPSVRRPGMEIAE
IMIEENDDPRGIFMFHVTRGAGEVITAYEVPPPLNVLQVPVVRLAGSFGAVNVYWKASPD
SAGLEDFKPSHGILEFADKQVTAMIEITIIDDAEFELTETFNISLISVAGGGRLGDDVVV
TVVIPQNDSPFGVFGFEEKTVMIDESLSSDDPDSYVTLTVVRSPGGKGTVRLEWTIDEKA
KHNLSPLNGTLHFDETESQKTIVLHTLQDTVLEEDRRFTIQLISIDEVEISPVKGSASII
IRGDKRASGEVGIAPSSRHILIGEPSAKYNGTAIISLVRGPGILGEVTVFWRIFPPSVGE
FAETSGKLTMRDEQSAVIVVIQALNDDIPEEKSFYEFQLTAVSEGGVLSESSSTANITVV
ASDSPYGRFAFSHEQLRVSEAQRVNITIIRSSGDFGHVRLWYKTMSGTAEAGLDFVPAAG
ELLFEAGEMRKSLHVEILDDDYPEGPEEFSLTITKVELQGRGYDFTIQENGLQIDQPPEI
GNISIVRIIIMKNDNAEGIIEFDPKYTAFEVEEDVGLIMIPVVRLHGTYGYVTADFISQS
SSASPGGVDYILHGSTVTFQHGQNLSFINISIIDDNESEFEEPIEILLTGATGGAVLGRH
LVSRIIIAKSDSPFGVIRFLNQSKISIANPNSTMILSLVLERTGGLLGEIQVNWETVGPN
SQEALLPQNRDIADPVSGLFYFGEGEGGVRTIILTIYPHEEIEVEETFIIKLHLVKGEAK
LDSRAKDVTLTIQEFGDPNGVVQFAPETLSKKTYSEPLALEGPLLITFFVRRVKGTFGEI
MVYWELSSEFDITEDFLSTSGFFTIADGESEASFDVHLLPDEVPEIEEDYVIQLVSVEGG
AELDLEKSITWFSVYANDDPHGVFALYSDRQSILIGQNLIRSIQINITRLAGTFGDVAVG
LRISSDHKEQPIVTENAERQLVVKDGATYKVDVVPIKNQVFLSLGSNFTLQLVTVMLVGG
RFYGMPTILQEAKSAVLPVSEKAANSQVGFESTAFQLMNITAGTSHVMISRRGTYGALSV
AWTTGYAPGLEIPEFIVVGNMTPTLGSLSFSHGEQRKGVFLWTFPSPGWPEAFVLHLSGV
QSSAPGGAQLRSGFIVAEIEPMGVFQFSTSSRNIIVSEDTQMIRLHVQRLFGFHSDLIKV
SYQTTAGSAKPLEDFEPVQNGELFFQKFQTEVDFEITIINDQLSEIEEFFYINLTSVEIR
GLQKFDVNWSPRLNLDFSVAVITILDNDDLAGMDISFPETTVAVAVDTTLIPVETESTTY
LSTSKTTTILQPTNVVAIVTEATGVSAIPEKLVTLHGTPAVSEKPDVATVTANVSIHGTF
SLGPSIVYIEEEMKNGTFNTAEVLIRRTGGFTGNVSITVKTFGERCAQMEPNALPFRGIY
GISNLTWAVEEEDFEEQTLTLIFLDGERERKVSVQILDDDEPEGQEFFYVFLTNPQGGAQ
IVEEKDDTGFAAFAMVIITGSDLHNGIIGFSEESQSGLELREGAVMRRLHLIVTRQPNRA
FEDVKVFWRVTLNKTVVVLQKDGVNLVEELQSVSGTTTCTMGQTKCFISIELKPEKVPQV
EVYFFVELYEATAGAAINNSARFAQIKILESDESQSLVYFSVGSRLAVAHKKATLISLQV
ARDSGTGLMMSVNFSTQELRSAETIGRTIISPAISGKDFVITEGTLVFEPGQRSTVLDVI
LTPETGSLNSFPKRFQIVLFDPKGGARIDKVYGTANITLVSDADSQAIWGLADQLHQPVN
DDILNRVLHTISMKVATENTDEQLSAMMHLIEKITTEGKIQAFSVASRTLFYEILCSLIN
PKRKDTRGFSHFAEVTENFAFSLLTNVTCGSPGEKSKTILDSCPYLSILALHWYPQQING
HKFEGKEGDYIRIPERLLDVQDAEIMAGKSTCKLVQFTEYSSQQWFISGNNLPTLKNKVL
SLSVKGQSSQLLTNDNEVLYRIYAAEPRIIPQTSLCLLWNQAAASWLSDSQFCKVVEETA
DYVECACSHMSVYAVYARTDNLSSYNEAFFTSGFICISGLCLAVLSHIFCARYSMFAAKL
LTHMMAASLGTQILFLASAYASPQLAEESCSAMAAVTHYLYLCQFSWMLIQSVNFWYVLV
MNDEHTERRYLLFFLLSWGLPAFVVILLIVILKGIYHQSMSQIYGLIHGDLCFIPNVYAA
LFTAALVPLTCLVVVFVVFIHAYQVKPQWKAYDDVFRGRTNAAEIPLILYLFALISVTWL
WGGLHMAYRHFWMLVLFVIFNSLQGLYVFMVYFILHNQMCCPMKASYTVEMNGHPGPSTA
FFTPGSGMPPAGGEISKSTQNLIGAMEEVPPDWERASFQQGSQASPDLKPSPQNGATFPS
SGGYGQGSLIADEESQEFDDLIFALKTGAGLSVSDNESGQGSQEGGTLTDSQIVELRRIP
IADTHL
NT seq 18921 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttcctggggccagggatgccctctgcatctttattagtaaatcttctttca
gctttactcatcctatttgtgtttggagaaacagaaataagatttactggacaaactgaa
tttgttgttaatgaaacaagtacaacagttattcgtcttatcattgaaaggataggagag
ccagcaaatgttactgcaattgtatcgctgtatggagaggacgctggtgacttttttgac
acatatgctgcagcttttatacctgccggagaaacaaacagaacagtgtacatagcagta
tgtgatgatgacttaccagagcctgacgaaacttttatttttcacttaacattacagaaa
ccttcagcaaatgtgaagcttggatggccaaggactgttactgtgacaatattatcaaat
gacaatgcatttggaattatttcatttaatatgcttccctcaatcgcagtgagtgagccc
aagggcagaaatgagtctatgcctcttactctcatcagggaaaagggaacctatggaatg
gtcatggtgacttttgaggtagagggtggcccaaatccccctgatgaagatttgagtcca
gttaaaggaaatatcacctttccccctggcagagcaacagtaatttataacttgacagta
ctcgatgacgaggtaccagaaaatgatgaaatatttttaattcaactgaaaagtgtagaa
ggaggagctgagattaacacctctaggaattccattgagatcatcattaagaaaaatgat
agtcccgtgagattccttcagagtatttatttggttcctgaggaagaccacatactcata
attccagtagttcgtggaaaggacaacaatggaaatctgattggatctgatgaatatgag
gtttcaatcagttatgctgtcacaactgggaattccacagcacatgcccagcaaaatctg
gacttcattgatcttcagccaaacacaactgttgtttttccaccttttattcatgaatct
cacttgaaatttcaaatagttgatgacaccataccggagattgctgaatcgtttcacatt
atgttactaaaagataccttacagggagatgctgtgctaataagcccttctgttgtacaa
gtcaccattaagccaaatgataaaccttatggagtcctttcattcaacagtgttttgttt
gaaaggacagttataattgatgaagatagaatatcaagatatgaagaaatcacagtggtt
agaaatggaggaacccatgggaatgtctctgcgaattgggtgttgacacggaacagcact
gatccctcaccagtaacagcagatatcagaccgagctctggagttctccattttgcacaa
gggcagatgttggcaacaattcctcttactgtggttgatgatgatcttccagaagaggca
gaagcttatctacttcaaattctgcctcatacaatacgaggaggtgcagaagtgagcgag
ccagcggagcttttgttctacattcaggatagtgatgatgtctatggcctaataacattt
tttcctatggaaaaccagaagattgaaagcagcccaggtgaacgatacttatccttgagt
tttacaagactaggagggactaaaggagatgtgaggttgctttattctgtactttacatt
cctgctggagctgtggaccccttgcaagcaaaagaaggcatcttaaatatatcaaggaga
aatgacctcatttttccagagcaaaaaactcaagtcactacaaaattaccaataagaaat
gatgcattccttcaaaatggagctcactttctagtacagttggaaactgtggagttgtta
aacataattcctctaatcccacccataagccctagatttggggaaatctgcaatatttct
ttactggttactccagccattgcaaatggagaaattggctttctcagcaatcttccaatt
attttgcatgaaccagaagattttgctgctgaagtggtatacattcccttacatcgggat
ggaactgatggccaggctactgtctactggagtttgaagccctctggctttaattcaaaa
gcagtgaccccggatgatataggcccctttaatggctctgttttgtttttatctgggcaa
agtgacacaacaatcaacattactatcaaaggtgatgacataccggaaatgaatgaaact
gtaacactttctctagacagggttaacgtggaaaaccaagtgctgaaatctggatatact
agccgtgacctaattattttggaaaatgatgaccctgggggagtttttgaattttctcct
gcttccagaggaccctatgttataaaagaaggagaatctgtagagctccacatcatccga
tcaagggggtcccttgttaagcagtttctacactaccgagtagagccaagagatagcaat
gaattctatggaaacacgggagtactagaatttaaacctggagaaagggagatagtgatc
accttgctagcaagattggatgggataccagagttggatgaacactactgggtggtcctc
agcagccacggagaacgggaaagcaagttgggaagtgccaccattgtcaatataacgatt
ctgaaaaatgatgatcctcatggcattatagaatttgtttctgatggtctaattgtgatg
ataaatgaaagcaaaggagatgctatctatagtgctgtttatgatgtagtaagaaatcga
ggcaactttggtgatgttagtgtatcatgggtggttagtccagactttacacaagatgta
tttcctgtacaagggactgttgtctttggagatcaggaattttcaaaaaatatcaccatt
tactcccttccagatgagattccagaagaaatggaagaatttaccgttatcctactgaat
ggcactggaggagctaaagtgggaaatagaacaactgcaactctgaggattagaagaaat
gatgaccccatttattttgcagaacctcgtgtagtgagggttcaggaaggtgagactgcc
aactttacagttctcagaaatggatctgttgatgtgacttgcatggtccagtatgctacc
aaggatgggaaggctactgcaagagagagagatttcattcctgttgaaaaaggagaaacg
ctcatttttgaggttggaagtagacagcagagcatatccatatttgttaatgaagatggt
atcccggaaacagatgagcccttttatataatcctcttgaattcaacaggtgatacagta
gtatatcaatatggagtagctacagtaataattgaagctaatgatgacccaaatggcatt
ttttctctggagcccatagacaaagcagtggaagaaggaaagactaatgcattttggatt
ttgaggcaccgaggatactttggtagtgtttctgtatcttggcagctctttcagaatgat
tctgctttgcagcctgggcaggagttctatgaaacttcaggaactgttaacttcatggat
ggagaagaagcaaaaccaatcattctccatgcttttccagataaaattcctgaattcaat
gaattttatttcctaaaacttgtaaacatttcaggtggatccccaggtcctgggggccag
ctagcagaaaccaacctccaggtgacagtaatggttccattcaatgatgatccctttgga
gtttttatcttggatccagagtgtttagagagagaagtggcagaagatgtcctgtctgaa
gatgatatgtcttatattaccaacttcaccattttgaggcagcagggtgtgtttggtgat
gtacaactgggctgggaaatactgtccagtgagttccctgctggtttgccaccaatgata
gattttttactggttggaattttccccaccaccgtgcatttacaacagcacatgcggcgt
caccacagtggaacggatgctttgtactttaccggactagagggtgcatttgggactgtt
aatccaaaataccatccctccaggaataatacaattgccaactttacattctcagcttgg
gtaatgcccaatgccaatacgaatggattcattatagcgaaggatgacggtaatggaagc
atctactacggggtaaaaatacaaacaaacgaatcccatgtgacactttcccttcattat
aaaaccttgggttccaatgctacatacattgccaagacaacagtcatgaaatatttagaa
gaaagtgtttggcttcatctactaattatcctggaggatggtataatcgaattctacctg
gatggaaatgcaatgcccaggggaatcaagagtctgaaaggagaagccattactgacggt
cctgggatactgagaattggagcagggataaatggcaatgacagatttacaggtctgatg
caggatgtgaggtcctatgagcggaaactgacgcttgaagaaatttatgaacttcatgcc
atgcccgcaaaaagtgatttacacccaatttctggatatctggagttcagacagggagaa
actaacaaatcattcattatttctgcaagagatgacaatgacgaggaaggagaagaatta
ttcattcttaaactagtttctgtatatggaggagctcgtatttcggaagaaaatactact
gcaagattaacaatacaaaaaagtgacaatgcaaatggcttgtttggtttcacaggagct
tgtataccagagattgcagaggagggatcaaccatttcttgtgtggttgagagaaccaga
ggagctctggattatgtgcatgttttttacaccatttcacagattgaaactgatggcatt
aattaccttgttgatgactttgctaatgccagtggaactattacattccttccttggcag
agatcagaggttctgaatatatatgttcttgatgatgatattcctgaacttaatgagtat
ttccgtgtgacattggtttctgcaattcctggagatgggaagctaggctcaactcctacc
agtggtgcaagcatagatcctgaaaaggaaacgactgatatcaccatcaaagctagtgat
catccatatggcttgctgcagttctccacagggctgcctcctcagcctaaggacgcaatg
accctgcctgcaagcagcgttccacatatcactgtggaggaggaagatggagaaatcagg
ttattggtcatccgtgcacagggacttctgggaagggtgactgcggaatttagaacagtg
tccttgacagcattcagtcctgaggattaccagaatgttgctggcacattagaatttcaa
ccaggagaaagatataaatacattttcataaacatcactgataattctattcctgaactg
gaaaaatcttttaaagttgagttgttaaacttggaaggaggagtagctgaactctttagg
gttgatggaagtggtagtggtgatggggacatggaattcttccttccaactattcacaaa
cgtgccagtctaggagtggcttcccaaattctagtgacaattgcagcctctgaccacgct
catggcgtatttgaatttagccctgagtcactctttgtcagtggaactgaaccagaagat
gggtatagcactgttacattaaatgttataagacatcatggaactctgtctccagtgact
ttgcattggaacatagactctgatcctgatggtgatctcgccttcacctctggcaacatc
acatttgagattgggcagacgagcgccaatatcactgtggagatattgcctgacgaagac
ccagaactggataaggcattctctgtgtcagtcctcagtgtttccagtggttctttggga
gctcatattaatgccacgttaacagttttggctagtgatgatccatatgggatattcatt
ttttctgagaaaaacagacctgttaaagttgaggaagcaacccagaacatcacactatca
ataataaggttgaaaggcctcatgggaaaagtccttgtctcatatgcaacactagatgat
atggaaaaaccaccttattttccacctaatttagcgagagcaactcaaggaagagactat
ataccagcttctggatttgctctttttggagctaatcagagtgaggcaacaatagctatt
tcaattttggatgatgatgagccagaaaggtccgaatctgtctttatcgaactactcaac
tctactttagtagcgaaagtacagagtcgttcaattccaaattctccacgtcttgggcct
aaggtagaaactattgcgcaactaattatcattgccaatgatgatgcatttggaactctt
cagctctcagcaccaattgtccgagtggcagaaaatcatgttggacccattatcaatgtg
actagaacaggaggagcatttgcagatgtctctgtgaagtttaaagctgtgccaataact
gcaatagctggtgaagattatagtatagcttcatcagatgtggtcttgctagaaggggaa
accagtaaagccgtgccaatatatgtcattaatgatatctatcctgaactggaagaatct
tttcttgtgcaactgatgaatgaaacaacaggaggagccagactaggggctttaacagag
gcagtcattattattgaggcctctgatgacccctatggattatttggttttcagattact
aaacttattgtagaggaacctgagtttaactcagtgaaggtaaacctgccaataattcga
aattctgggacactcggcaatgttactgttcagtgggttgccaccattaatggacagctt
gctactggcgacctgcgagttgtctcaggtaatgtgacctttgcccctggggaaaccatt
caaaccttgttgttagaggtcctggctgacgacgttccggagattgaagaggttatccaa
gtgcaactaactgatgcctctggtggaggtactattgggttagatcgaattgcaaatatt
attattcctgccaatgatgatccttatggtacagtagcctttgctcagatggtttatcgt
gttcaagagcctctggaaagaagttcctgtgctaatataactgtcaggcgaagcggaggg
cactttggtcggctgttgttgttctacagtacttccgacattgatgtagtggctctggca
atggaggaaggtcaagatttactgtcctactatgaatctccaattcaaggggtgcctgac
ccactttggagaacttggatgaatgtctctgccgtgggggagcccctgtatacctgtgcc
actttgtgccttaaggaacaagcttgctcagcgttttcatttttcagtgcttctgagggt
ccccagtgtttctggatgacatcatggatcagcccagctgtcaacaattcagacttctgg
acctacaggaaaaacatgaccagggtagcatctctttttagtggtcaggctgtggctggg
agtgactatgagcctgtgacaaggcaatgggccataatgcaggaaggtgatgaattcgca
aatctcacagtgtctattcttcctgatgatttcccagagatggatgagagttttctaatt
tctctccttgaagttcacctcatgaacatttcagccagtttgaaaaatcagccaaccata
ggacagccaaatatttctacagttgtcatagcactaaatggtgatgcctttggagtgttt
gtgatctacaatattagtcccaatacttccgaagatggcttatttgttgaagttcaggag
cagccccaaaccttggtggagctgatgatacacaggacagggggcagcttaggtcaagtg
gcagtcgaatggcgtgttgttggtggaacagctactgaaggtttagattttataggtgct
ggagagattctgacctttgctgaaggtgaaaccaaaaagacagtcattttaaccatcttg
gatgactctgaaccagaggatgacgaaagtatcatagttagtttggtgtacactgaaggt
ggaagtagaattttgccaagctccgacactgttagagtgaacattttggccaatgacaat
gtggcaggaattgttagctttcagacagcttccagatctgtcataggtcatgaaggagaa
attttacaattccatgtgataagaactttccctggtcgaggaaatgttactgttaactgg
aaaattattgggcaaaatctagaactcaattttgctaactttagcggacaacttttcttt
cctgaggggtcgttgaatacaacattgtttgtgcatttgttggatgacaacattcctgag
gagaaagaagtataccaagtcattctgtatgatgtcaggacacaaggagttccaccagcc
ggaatcgccctgcttgatgctcaaggatatgcagctgtcctcacagtagaagccagtgat
gaaccacatggagttttaaattttgctctttcatcaagatttgtgttactacaagaggct
aacataacaattcagcttttcatcaacagagaatttggatctctaggagctatcaatgtc
acatataccacggttcctggaatgctgagtctgaagaaccaaacagtaggaaacctagca
gagccagaagttgattttgtccctatcattggctttctgattttagaagaaggggaaaca
gcagcagccatcaacattaccattcttgaggatgatgtaccagagctagaagaatatttc
ctggtgaatttaacttacgttggacttaccatggctgcttcaacttcatttcctcccaga
ctagattcagaaggtttgactgcacaagttattattgatgccaatgatggggcccgaggt
gtaattgaatggcaacaaagcaggtttgaagtaaatgaaacccatggaagtttaacattg
gtagcccagaggagcagagaacctcttggccatgtttccttatttgtgtatgctcagaat
ttggaagcacaagtggggctggattatatcttcaccccaatgattcttcattttgctgat
ggagaaaggtataaaaatgtcaatatcatgattcttgatgatgacattccagaaggagat
gaaaaatttcagctgattttaacaaatccttctcctggactagagctagggaaaaataca
atagccttaattattgtccttgctaatgatgacggccctggagttctatcatttaacaac
agtgagcactttttcctaagagagccaacagctctctacgtccaggagagtgttgcagta
ttgtacattgttcgggaacctgcacaaggattgtttggaacagtgacagttcagttcatt
gtgacagaagtgaattcctcaaatgaatctaaagatctgactccttccaaaggctatatt
gttttagaagaaggtgttcgattcaaggccctacaaatatctgccatattagacacggaa
ccagaaatggatgagtattttgtttgcaccttgtttaatccaactggaggtgctagacta
ggggtgcatgttcaaaccctgataacagttttgcaaaaccaggcccctttggggctattc
agtatctctgcagttgaaaatagagccacctccatagacatcgaagaagccaataggacc
gtgtatttaaatgtatctcgaactaatggcattgatttggctgtgagtgtgcagtgggag
acagtatctgaaacagcctttggcatgaggggaatggatgttgtgttttccgtatttcaa
agttttttggatgaatcagcttctggctggtgtttctttactttggaaaatttaatatat
ggtataatgttaagaaaatcatctgttactgtttaccgatggcaggggatttttattcca
gttgaggatttaaatatagaaaatcctaaaacttgtgaggcctttaatattggtttttct
ccctactttgtgattactcatgaagaaagaaatgaagaaaagccttctcttaacagtgtg
tttacattcacatctggatttaaattattcctggtacaaacaatcattattctggaaagt
tctcaagtaagatattttacttcagacagccaagattatttaatcattgcaagtcaaaga
gatgattccgaattaactcaggtcttcaggtggaatggaggaagcttcgtgttgcatcaa
aaactccctgtccgaggtgtgctgaccgtggccttgttcaacaagggaggctctgtgttc
ttagccatttcccaggctaatgccaggctaaactcccttttattcagatggtctggcagt
gggtttattaactttcaagaggtgcctgtcagtgggacaacagaagttgaggctttgtct
tcagccaatgatatttacctaatatttgccgaaaatgtctttctaggagatcagaattca
attgatattttcatctgggagatgggacagtcttccttcaggtattttcagtctgtagat
tttgctgctgttaacagaatccactccttcacaccagcctcaggaatagcccacatactt
cttattggccaagatatgtctgctctttactgctggaattcggagcgtaatcaattctct
tttgttctggaagtaccttctgcttatgatgtggcttctgttacagtaaagtcccttaat
tcaagcaagaatttaatagctctagtgggagctcattcacatatatatgagctagcctac
atttccagccattctgactttattcctagttcaggtgaactgatatttgaacctggtgag
agagaagctacaatagcagtaaatatccttgatgatacagttccagaaaaagaagaatcc
ttcaaagttcaacttaaaaatcccaaaggaggagcagagattggcattaatgattctgta
acaataaccattctgtctaatgatgatgcctatggaattgttgcatttgctcagaattca
ttatataagcaagtggaagaaatggagcaagatagcctagtaaccttgaacgttgaacgc
ttaaaaggaacatatggccgtataaccatagcatgggaagctgatggaagtattagtgat
atatttcctacctcaggagtgattttatttactgaaggccaggtactgtcaacaatcact
ctaactattcttgctgataatataccagagttatcagaggttgtgattgtaaccctcacc
cgtatcaccacagaaggggttgaggactcatacaaaggtgctactattgatcaggacaga
agcaagtctgttataacaactttgcccaatgactcaccttttggcttggtgggctggcgt
gctgcgtctgtcttcattagagtagcagagcctaaagaaaacaccaccactcttcagtta
caaatagctcgagataaaggactacttggggatattgccattcacttgagagctcaaccc
aatttcttactgcatgtcgataatcaagctactgagaatgaagattatgtattgcaagaa
acaataataataatgaaagaaaacataaaagaagctcatgccgaagtttccattttgccg
gatgaccttcctgaattggaggaaggatttattgtcactatcactgaggtgaacctggtg
aactctgacttctctacaggacagccaagtgtgcggaggcccggaatggaaatagctgag
ataatgatagaagaaaatgacgatcccagaggaatttttatgtttcatgttactagaggc
gctggggaagttattactgcctatgaggtgcctccacccttgaacgttcttcaagttcct
gtagtccggctggctggaagctttggggcagtaaatgtttattggaaagcatcaccagac
agtgctggcctggaagactttaaaccatctcatgggattcttgaatttgcagataaacag
gttactgcaatgatagaaatcaccataattgatgatgctgaatttgaattgacagagacg
ttcaatatttccttgatcagtgttgctggaggtggcagacttggtgatgatgttgtggta
actgttgttattccacaaaatgattctccatttggagtatttggatttgaagaaaagact
gtaatgattgatgaatccctttcatccgatgaccctgattcatatgtgacattgacggtt
gtccggtccccaggaggaaaaggaaccgtccgacttgagtggaccatagatgagaaggct
aaacataaccttagtcctttgaatgggacccttcattttgatgagactgagtcccagaag
accattgtgttgcacacacttcaagacacagtgttggaggaggacaggcgtttcaccatt
cagctgatatcaattgatgaggtagaaatatctccagtaaaaggtagtgcatcaataatt
attcggggtgataagcgagcatcaggagaagttgggatagctccgtcatctaggcacatc
ctcattggggaaccctcagcaaaatataatggtaccgctattatcagccttgttcgaggc
ccagggattttgggggaggtcacagtgttctggaggatattccctccttccgtgggggaa
tttgctgaaacatcaggaaaactgacaatgcgagacgaacagtctgcagtcattgtagta
atacaggctttgaacgatgacattcccgaggaaaaaagcttctatgagtttcagctcact
gcagtcagtgagggaggagttctgagtgaatccagcagcactgccaacatcacggtggtg
gccagcgactctccctatggccgatttgccttttcacatgagcaacttcgagtgtcagaa
gcacagagggttaacatcacaatcatccgttccagtggagattttggccatgtgcgactc
tggtacaagacgatgagcgggacagcggaagcaggcttggattttgttcctgcagcaggg
gagctcctctttgaagcaggggagatgaggaaaagtctgcatgttgaaatccttgatgat
gactatcctgaaggcccagaggaattttctctaacaattacaaaggtggaactccaggga
agagggtatgattttaccattcaagaaaatggacttcagatagatcaacctcctgaaata
ggaaacatctccattgttcgcatcataataatgaaaaatgataacgcagaaggcatcatt
gaatttgacccaaagtatactgccttcgaagtggaggaagatgttgggctgatcatgatc
ccagtggtgaggctacatggaacttatggctatgtgacagctgatttcatctctcagagc
tcctctgccagtcccggaggtgttgattacattttgcatggcagtacagtcacctttcag
catgggcaaaacttaagttttataaatatctccatcattgatgacaatgaaagtgaattt
gaggagcccattgaaattctactcactggagctactggaggagcggtccttgggcgccac
ctagtgagcagaatcataatagctaagagtgactctccctttggagttataaggtttctc
aatcaaagcaaaatttctattgctaatcccaattccacaatgattttatcactggtgctg
gagcggactggaggactcttgggagagattcaggtgaactgggagacagtaggacccaac
tctcaagaagccttactgccacagaatagagacattgcagacccagtgagcgggttgttc
tattttggagaaggagaaggaggagtgagaaccataattctgacaatctatcctcatgaa
gaaattgaagttgaagagacattcattattaaacttcatcttgtgaaaggagaagctaaa
ttagactccagagctaaagatgttacattaaccatacaagagtttggtgacccaaatgga
gttgttcagtttgctcctgaaactttgtctaagaagacttattcagagcctctggctctg
gaagggcccctgctcattaccttctttgtcagaagagtcaagggcacctttggagagatt
atggtttactgggaattaagtagtgagtttgacattactgaagactttctttccaccagt
ggatttttcaccattgctgatggagagagtgaagctagctttgatgttcatttgctacca
gatgaggtacctgagatagaggaagattatgtgatccagcttgtttctgtagagggagga
gccgaactggatctggagaagagtatcacatggttctctgtttatgcaaatgatgaccca
catggagtatttgccctgtattcggatcgccagtcaatacttattgggcagaaccttatt
agatccatccaaattaacataacccggcttgctggaacatttggagatgtggctgttggg
cttcgaatatcatcggatcataaagaacagccgattgttaccgaaaatgcagagaggcag
ctggtggtcaaagatggtgccacatataaagtggacgtggtgccaataaagaatcaggtc
ttcctatcactgggctctaatttcactttgcaactggtgactgtgatgcttgtcggtgga
cgtttctatggaatgccaacaattcttcaggaagcaaaatctgctgtccttccagtctct
gagaaagctgccaattctcaggtcggatttgaatccactgcttttcaactcatgaacatc
actgctggcacaagccacgttatgatttctaggagaggcacatatggagctctctcggtt
gcctggaccactggatatgctcctgggttagaaattcctgaattcattgttgttggcaac
atgaccccaacactggggagcctttcattttcccacggtgaacaaaggaaaggagttttc
ctgtggacgtttcctagccctggttggccagaggcctttgttcttcacctatcaggagtg
cagagcagtgctcctggcggagctcaactccgatcaggtttcattgttgctgaaattgaa
ccaatgggcgtcttccaattttccactagctcaagaaatatcatagtgtcagaagataca
cagatgatcagattacatgtacaaagactatttgggttccacagcgatcttattaaagtt
tcttatcagaccactgcaggaagcgccaagccactggaagattttgagcctgttcagaat
ggggaactgttttttcaaaaattccaaactgaggttgattttgaaataaccattattaat
gatcagctttctgagatagaagaatttttttacattaaccttacttcagtagaaattagg
ggattacaaaagtttgatgttaattggagcccacgcctgaatctagatttcagtgttgca
gtgattacaatattggataatgatgacctggcaggaatggatatttccttccccgagaca
actgtggctgtagcagttgacacaactctcattcctgtagaaactgaatccaccacatac
ctcagcacaagcaagacgactaccattctgcagccaaccaacgtggttgccattgttact
gaggcaactggtgtatctgccatccctgagaaacttgtcacccttcatggcacacctgct
gtgtctgaaaagcctgatgtggccactgtaactgccaatgtttccattcatggaacattc
agccttgggccatccattgtttatattgaagaggagatgaagaatggcacattcaacact
gcagaagttcttatccgaagaactggtgggtttactggcaatgtcagcataacagttaaa
actttcggtgaaagatgtgctcagatggaaccaaatgcattgccctttcgtggtatctat
gggatttccaacctaacatgggcagttgaagaagaagactttgaagaacaaactcttacc
cttatattcctagatggagaaagagaacgtaaagtatcagttcaaattttggatgatgat
gagcctgaggggcaggaattcttctacgtgtttctcacaaaccctcaagggggagcacag
attgtggaggagaaggatgatactggatttgcagcttttgccatggttattattacaggg
agtgaccttcacaatggcatcataggattcagtgaggagtcccagagtggactagaactc
agggaaggagctgttatgagaagattgcaccttattgtcacaagacagccaaacagggcc
tttgaagatgtcaaggtcttttggcgagtcacacttaacaaaacagtcgtcgtgctccag
aaggatggggtaaacctggtggaggaacttcagtctgtgtcagggaccacaacctgtaca
atgggtcaaacaaaatgctttatcagcattgaactcaaaccagaaaaggtaccacaggtt
gaagtgtatttttttgtggaactatatgaagctactgctggagcagcaataaacaacagt
gccagattcgcacagattaaaatcttagaaagtgatgaatctcaaagccttgtgtatttt
tctgtgggttctcggctggcagtggctcacaagaaggccactttaatcagtctgcaggtg
gccagagattctgggacaggactaatgatgtctgttaactttagtacccaggagttgagg
agtgctgaaacaattggtcgtaccatcatatctccagctatttctggaaaggattttgtg
ataactgaaggcacattggtctttgaacctggccagagaagcactgtattggatgtcatc
ctaacgccagagacaggatctttaaattcatttcctaaacgcttccagattgtccttttt
gacccaaaaggtggtgccagaattgataaagtgtatgggactgccaacatcactcttgtc
tcagatgcagattcgcaggccatttgggggcttgcagatcagctacatcagcctgtgaat
gatgatattctcaacagagtgctccataccatcagcatgaaagtggccacagaaaacaca
gatgaacaactcagtgccatgatgcatttaatagaaaagataactactgaaggaaaaatt
caagctttcagtgttgccagccgaactcttttctatgagattctttgttctcttattaac
ccaaagcgcaaggacactaggggattcagtcactttgctgaagtgactgagaattttgcc
ttttctctgctgactaatgttacttgcggctctcctggtgaaaaaagcaaaaccatcctt
gatagttgcccatatttgtcaatattggctcttcactggtatcctcagcaaatcaatgga
cacaagtttgaaggaaaggaaggagattacattcgaattccagagaggctactggatgtc
caggatgcagaaataatggctgggaaaagtacatgtaaattagtccagtttacagagtat
agcagccaacagtggtttataagtggaaacaatcttcctaccctaaaaaataaggtatta
tctttgagtgtgaaaggtcagagttcacaactcctgactaatgacaatgaggttctctac
aggatttatgctgctgagcctagaattattcctcagacatctctgtgtctcctttggaat
caggctgctgcaagctggttgtctgacagtcagttttgcaaagtggttgaggaaactgca
gactatgtggaatgtgcctgttcacacatgtctgtgtatgctgtctatgctcggactgac
aacttgtcttcatacaatgaagccttcttcacttctggatttatatgtatctcaggtctt
tgcttggctgttctttcccatatcttctgtgccaggtactccatgtttgcagctaaactt
ctgactcacatgatggcagccagcttaggtacacagattctgtttctggcgtctgcatac
gcaagtccccaactcgctgaggagagctgttcagctatggctgctgtcacacattacctg
tatctttgccagtttagctggatgctcattcagtctgtgaatttctggtacgtgctggtg
atgaatgatgagcacacagagaggcgatatctgctgtttttccttctgagttggggacta
ccagcttttgtggtgattctcctcatagttattttgaaaggaatctatcatcagagcatg
tcacagatctatggactcattcatggtgacctgtgttttattccaaacgtctatgctgct
ttgttcactgcagctcttgttcctttgacgtgcctcgtggtggtgttcgtggtgttcatc
catgcctaccaggtgaagccacagtggaaagcatatgatgatgtcttcagaggaaggaca
aatgctgcagaaattccactgattttatatctctttgctctgatttccgtgacatggctt
tggggaggactacacatggcctacagacacttctggatgttggttctctttgtcattttc
aacagtctgcagggactttatgttttcatggtttatttcattttacacaaccaaatgtgt
tgccctatgaaggccagttacactgtggaaatgaatgggcatcctggacccagcacagcc
tttttcacgcccgggagtggaatgcctcctgctggaggggaaatcagcaagtccacccag
aatctcatcggtgctatggaggaggtgccacctgactgggagagagcatccttccaacag
ggcagtcaggccagccctgatttaaagccaagtccacaaaatggagccacgttcccgtcc
tctggaggatatggccaggggtcactgatagccgatgaggagtcccaggagtttgatgat
ttaatatttgcattaaaaactggtgctggtctcagtgtcagtgataatgaatctggtcaa
ggcagccaggaggggggcaccttgactgactcccagatcgtggagctcaggaggataccc
atcgccgacactcacctgtag

DBGET integrated database retrieval system