KEGG   Homo sapiens (human): 84061Help
Entry
84061             CDS       T01001                                 

Gene name
MAGT1, IAP, MRX95, OST3B, PRO0756, XMEN, bA217H1.1
Definition
(RefSeq) magnesium transporter 1
  KO
K19478  magnesium transporter 1
Organism
hsa  Homo sapiens (human)
Disease
H00480  Non-syndromic X-linked mental retardation
Brite
Transporters [BR:hsa02000]
 Other Transporters
  Others
   84061 (MAGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OST3_OST6 Thioredoxin DUF4131
Motif
Other DBs
NCBI-GeneID: 84061
NCBI-ProteinID: NP_115497
OMIM: 300715
HGNC: 28880
Ensembl: ENSG00000102158
Vega: OTTHUMG00000021882
Pharos: Q9H0U3(Tbio)
UniProt: Q9H0U3 A0A087WU53
Position
Xq21.1
AA seq 367 aa AA seqDB search
MRKGKGPICLFSRPTLRPSRSKVSLIEGRGANMAARWRFWCVSVTMVVALLIVCDVPSAS
AQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCV
VCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKP
KRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRS
NMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAE
THIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGY
PYSFLMS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaggcaaggggccgatttgcctgttctcacgccccaccctcagacctagccgg
agcaaagtttcacttatagaagggagaggagcgaacatggcagcgcgttggcggttttgg
tgtgtctctgtgaccatggtggtggcgctgctcatcgtttgcgacgttccctcagcctct
gcccaaagaaagaaggagatggtgttatctgaaaaggttagtcagctgatggaatggact
aacaaaagacctgtaataagaatgaatggagacaagttccgtcgccttgtgaaagcccca
ccgagaaattactccgttatcgtcatgttcactgctctccaactgcatagacagtgtgtc
gtttgcaagcaagctgatgaagaattccagatcctggcaaactcctggcgatactccagt
gcattcaccaacaggatattttttgccatggtggattttgatgaaggctctgatgtattt
cagatgctaaacatgaattcagctccaactttcatcaactttcctgcaaaagggaaaccc
aaacggggtgatacatatgagttacaggtgcggggtttttcagctgagcagattgcccgg
tggatcgccgacagaactgatgtcaatattagagtgattagacccccaaattatgctggt
ccccttatgttgggattgcttttggctgttattggtggacttgtgtatcttcgaagaagt
aatatggaatttctctttaataaaactggatgggcttttgcagctttgtgttttgtgctt
gctatgacatctggtcaaatgtggaaccatataagaggaccaccatatgcccataagaat
ccccacacgggacatgtgaattatatccatggaagcagtcaagcccagtttgtagctgaa
acacacattgttcttctgtttaatggtggagttaccttaggaatggtgcttttatgtgaa
gctgctacctctgacatggatattggaaagcgaaagataatgtgtgtggctggtattgga
cttgttgtattattcttcagttggatgctctctatttttagatctaaatatcatggctac
ccatacagctttctgatgagttaa

DBGET integrated database retrieval system