KEGG   Homo sapiens (human): 84061Help
Entry
84061             CDS       T01001                                 

Gene name
MAGT1, IAP, MRX95, OST3B, PRO0756, XMEN, bA217H1.1
Definition
magnesium transporter 1
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq21.1
AA seq 367 aa AA seqDB search
MRKGKGPICLFSRPTLRPSRSKVSLIEGRGANMAARWRFWCVSVTMVVALLIVCDVPSAS
AQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCV
VCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKP
KRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRS
NMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAE
THIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGY
PYSFLMS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaggcaaggggccgatttgcctgttctcacgccccaccctcagacctagccgg
agcaaagtttcacttatagaagggagaggagcgaacatggcagcgcgttggcggttttgg
tgtgtctctgtgaccatggtggtggcgctgctcatcgtttgcgacgttccctcagcctct
gcccaaagaaagaaggagatggtgttatctgaaaaggttagtcagctgatggaatggact
aacaaaagacctgtaataagaatgaatggagacaagttccgtcgccttgtgaaagcccca
ccgagaaattactccgttatcgtcatgttcactgctctccaactgcatagacagtgtgtc
gtttgcaagcaagctgatgaagaattccagatcctggcaaactcctggcgatactccagt
gcattcaccaacaggatattttttgccatggtggattttgatgaaggctctgatgtattt
cagatgctaaacatgaattcagctccaactttcatcaactttcctgcaaaagggaaaccc
aaacggggtgatacatatgagttacaggtgcggggtttttcagctgagcagattgcccgg
tggatcgccgacagaactgatgtcaatattagagtgattagacccccaaattatgctggt
ccccttatgttgggattgcttttggctgttattggtggacttgtgtatcttcgaagaagt
aatatggaatttctctttaataaaactggatgggcttttgcagctttgtgttttgtgctt
gctatgacatctggtcaaatgtggaaccatataagaggaccaccatatgcccataagaat
ccccacacgggacatgtgaattatatccatggaagcagtcaagcccagtttgtagctgaa
acacacattgttcttctgtttaatggtggagttaccttaggaatggtgcttttatgtgaa
gctgctacctctgacatggatattggaaagcgaaagataatgtgtgtggctggtattgga
cttgttgtattattcttcagttggatgctctctatttttagatctaaatatcatggctac
ccatacagctttctgatgagttaa

DBGET integrated database retrieval system