KEGG   Homo sapiens (human): 8408Help
Entry
8408              CDS       T01001                                 

Gene name
ULK1, ATG1, ATG1A, UNC51, Unc51.1, hATG1
Definition
unc-51 like autophagy activating kinase 1 (EC:2.7.11.1)
Orthology
K08269  
serine/threonine-protein kinase ULK/ATG1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.3
AA seq 1050 aa AA seqDB search
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMV
PAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSP
PAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSA
PEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRT
LPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESL
QEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTG
SASSSARHLVPGPCSEAPAPELPAPGHGCSFADPIAANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRF
FLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHM
LSDQADIENVTKCKLCIERRLSALLTGICA
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggagcccggccgcggcggcacagagaccgtgggcaagttcgagttctcccgcaaggac
ctgatcggccacggcgccttcgcggtggtcttcaagggccgccaccgcgagaagcacgat
ttggaggtcgccgtcaagtgcattaacaagaagaacctcgccaagtctcagacgctgctg
gggaaggaaatcaaaatcctgaaggaactgaaacatgaaaacatcgtggccctgtacgac
ttccaggaaatggctaattctgtctacctggttatggagtactgcaacggtggggacctg
gccgactacctgcacgccatgcgcacgctgagcgaggacaccatcaggctcttcctgcag
cagatcgcgggcgccatgcggcttctgcacagcaaaggcatcatccaccgcgacctgaaa
ccgcagaacatcctgctgtccaaccccgccggccgccgcgccaaccccaacagcatccgc
gtcaagatcgctgacttcggcttcgcgcggtacctccagagcaacatgatggcggccaca
ctctgcggctcccccatgtacatggcccccgaggtcatcatgtcccagcactacgacggg
aaggcggacctgtggagcatcggcaccatcgtctaccagtgcctgacggggaaggcgccc
ttccaggccagcagcccccaggacctgcgcctgttctacgagaagaacaagacgttggtc
cccaccatcccccgggagacctcggccccgctgcggcagctgctcctggccctactgcaa
cgcaaccacaaggaccgcatggacttcgatgagttttttcatcaccctttcctcgatgcc
agcccctcggtcaggaaatccccacccgtgcctgtgccctcgtacccaagctcggggtcc
ggcagcagctccagcagcagctccacctcccacctggcctccccgccgtccctgggcgag
atgcagcagctgcagaagaccctggcctccccggctgacaccgctggcttcctgcacagc
tcccgggactctggtggcagcaaggactcttcctgtgacacagacgacttcgtcatggtc
cccgcgcagtttccaggtgacctggtggctgaggcgcccagtgccaaacccccgccagac
agcctgatgtgcagtgggagctcactggtggcctctgcgggcttggagagccacggccgg
accccatctccatccccaccctgcagcagctcccccagtccctcaggccgggctggcccg
ttctccagcagcaggtgcggcgcctctgtccccatcccagtccccacgcaggtgcagaac
taccagcgcattgagcgaaacctgcagtcacccacccagttccaaacacctcggtcctct
gccatccgcaggtcaggcagcaccagccccctgggctttgcaagggccagcccctcgccc
cctgcccacgctgagcatggaggcgtcctggccaggaagatgtctctgggtggaggccgg
ccctacacgccatctcctcaagttggaaccatccctgagcggccaggctggagcgggacg
ccctccccacagggagctgagatgcggggtggcaggtcccctcgtccaggctcctctgca
cccgagcactctccccgcacttccgggctgggctgccgcctgcacagcgcccccaacctg
tctgacttgcacgtcgtccgccccaagctgcccaaaccccccacggaccccctgggagct
gtgttcagcccaccacaggccagccctccccagccgtcccacggcctgcagtcctgccgg
aacctgcggggctcacccaagctgcccgacttcctgcagcgaaaccccctgccccccatc
ctgggctcccccaccaaggctgtgccctcctttgacttcccgaagacccccagctcccag
aacctgctggccctcctagcccggcagggcgtggtgatgacgccccctcgaaaccggacg
ctgcccgacctctcggaggtgggacccttccatggtcagccgttgggccctggcctgcgg
ccaggcgaggaccccaagggcccctttggccggtctttcagcaccagccgcctcactgac
ctgctccttaaggcggcgtttgggacacaagccccggacccgggcagcacggagagcctg
caggagaagcccatggagatcgcaccctcagctggctttggagggagcctgcacccagga
gcccgtgctgggggcaccagcagcccttccccggtggtcttcaccgtgggctctcccccg
agcgggagcacgcccccccagggcccccgcaccaggatgttctcagcgggccccactggc
tctgccagctcttctgcccgccacctggtgcctgggccctgcagcgaggccccagcccct
gagctccctgctccaggacacggctgcagctttgccgaccccattgctgcgaacctggag
ggggctgtgaccttcgaggcccccgacctccctgaggagaccctcatggagcaagagcac
acggagatcctgcgtggcctgcgcttcacgctgctgttcgtgcagcacgtcctggagatc
gcagccctgaagggcagcgccagtgaggcggcggggggccctgagtaccagctgcaggag
agtgtggtggccgaccagatcagcctgctgagccgagaatggggcttcgcggaacagctg
gtgctgtacctgaaggtggccgagctactgtcctccggcctgcaaagtgccatcgaccag
atccgggccggcaagctctgcctgtcgtccactgtgaagcaggtggtgcgcaggctgaat
gagctgtacaaggccagcgtggtgtcctgccagggcctgagcctgcggctgcagcgcttc
ttcctggacaagcagcggctcctggaccgcattcacagcatcactgccgagaggctcatc
ttcagccacgctgtgcagatggtgcagtcggctgccctggacgagatgttccagcaccgt
gagggctgcgtcccacgctaccacaaggccctgctgctcctggaggggctgcagcacatg
ctctcggaccaggccgacatcgagaacgtcaccaagtgcaagctgtgcattgagcggaga
ctctcggcgctgctgactggcatctgtgcctga

DBGET integrated database retrieval system