KEGG   Homo sapiens (human): 8408Help
Entry
8408              CDS       T01001                                 

Gene name
ULK1, ATG1, ATG1A, UNC51, Unc51.1, hATG1
Definition
(RefSeq) unc-51 like autophagy activating kinase 1 (EC:2.7.11.1)
  KO
K08269  
serine/threonine-protein kinase ULK/ATG1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
mTOR signaling pathway
AMPK signaling pathway
Longevity regulating pathway - mammal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    8408 (ULK1)
   04150 mTOR signaling pathway
    8408 (ULK1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    8408 (ULK1)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    8408 (ULK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8408 (ULK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  ULK family [OT]
   8408 (ULK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    8408 (ULK1)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   8408 (ULK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.3
AA seq 1050 aa AA seqDB search
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMV
PAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSP
PAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSA
PEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRT
LPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESL
QEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTG
SASSSARHLVPGPCSEAPAPELPAPGHGCSFADPIAANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRF
FLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHM
LSDQADIENVTKCKLCIERRLSALLTGICA
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggagcccggccgcggcggcacagagaccgtgggcaagttcgagttctcccgcaaggac
ctgatcggccacggcgccttcgcggtggtcttcaagggccgccaccgcgagaagcacgat
ttggaggtcgccgtcaagtgcattaacaagaagaacctcgccaagtctcagacgctgctg
gggaaggaaatcaaaatcctgaaggaactgaaacatgaaaacatcgtggccctgtacgac
ttccaggaaatggctaattctgtctacctggttatggagtactgcaacggtggggacctg
gccgactacctgcacgccatgcgcacgctgagcgaggacaccatcaggctcttcctgcag
cagatcgcgggcgccatgcggcttctgcacagcaaaggcatcatccaccgcgacctgaaa
ccgcagaacatcctgctgtccaaccccgccggccgccgcgccaaccccaacagcatccgc
gtcaagatcgctgacttcggcttcgcgcggtacctccagagcaacatgatggcggccaca
ctctgcggctcccccatgtacatggcccccgaggtcatcatgtcccagcactacgacggg
aaggcggacctgtggagcatcggcaccatcgtctaccagtgcctgacggggaaggcgccc
ttccaggccagcagcccccaggacctgcgcctgttctacgagaagaacaagacgttggtc
cccaccatcccccgggagacctcggccccgctgcggcagctgctcctggccctactgcaa
cgcaaccacaaggaccgcatggacttcgatgagttttttcatcaccctttcctcgatgcc
agcccctcggtcaggaaatccccacccgtgcctgtgccctcgtacccaagctcggggtcc
ggcagcagctccagcagcagctccacctcccacctggcctccccgccgtccctgggcgag
atgcagcagctgcagaagaccctggcctccccggctgacaccgctggcttcctgcacagc
tcccgggactctggtggcagcaaggactcttcctgtgacacagacgacttcgtcatggtc
cccgcgcagtttccaggtgacctggtggctgaggcgcccagtgccaaacccccgccagac
agcctgatgtgcagtgggagctcactggtggcctctgcgggcttggagagccacggccgg
accccatctccatccccaccctgcagcagctcccccagtccctcaggccgggctggcccg
ttctccagcagcaggtgcggcgcctctgtccccatcccagtccccacgcaggtgcagaac
taccagcgcattgagcgaaacctgcagtcacccacccagttccaaacacctcggtcctct
gccatccgcaggtcaggcagcaccagccccctgggctttgcaagggccagcccctcgccc
cctgcccacgctgagcatggaggcgtcctggccaggaagatgtctctgggtggaggccgg
ccctacacgccatctcctcaagttggaaccatccctgagcggccaggctggagcgggacg
ccctccccacagggagctgagatgcggggtggcaggtcccctcgtccaggctcctctgca
cccgagcactctccccgcacttccgggctgggctgccgcctgcacagcgcccccaacctg
tctgacttgcacgtcgtccgccccaagctgcccaaaccccccacggaccccctgggagct
gtgttcagcccaccacaggccagccctccccagccgtcccacggcctgcagtcctgccgg
aacctgcggggctcacccaagctgcccgacttcctgcagcgaaaccccctgccccccatc
ctgggctcccccaccaaggctgtgccctcctttgacttcccgaagacccccagctcccag
aacctgctggccctcctagcccggcagggcgtggtgatgacgccccctcgaaaccggacg
ctgcccgacctctcggaggtgggacccttccatggtcagccgttgggccctggcctgcgg
ccaggcgaggaccccaagggcccctttggccggtctttcagcaccagccgcctcactgac
ctgctccttaaggcggcgtttgggacacaagccccggacccgggcagcacggagagcctg
caggagaagcccatggagatcgcaccctcagctggctttggagggagcctgcacccagga
gcccgtgctgggggcaccagcagcccttccccggtggtcttcaccgtgggctctcccccg
agcgggagcacgcccccccagggcccccgcaccaggatgttctcagcgggccccactggc
tctgccagctcttctgcccgccacctggtgcctgggccctgcagcgaggccccagcccct
gagctccctgctccaggacacggctgcagctttgccgaccccattgctgcgaacctggag
ggggctgtgaccttcgaggcccccgacctccctgaggagaccctcatggagcaagagcac
acggagatcctgcgtggcctgcgcttcacgctgctgttcgtgcagcacgtcctggagatc
gcagccctgaagggcagcgccagtgaggcggcggggggccctgagtaccagctgcaggag
agtgtggtggccgaccagatcagcctgctgagccgagaatggggcttcgcggaacagctg
gtgctgtacctgaaggtggccgagctactgtcctccggcctgcaaagtgccatcgaccag
atccgggccggcaagctctgcctgtcgtccactgtgaagcaggtggtgcgcaggctgaat
gagctgtacaaggccagcgtggtgtcctgccagggcctgagcctgcggctgcagcgcttc
ttcctggacaagcagcggctcctggaccgcattcacagcatcactgccgagaggctcatc
ttcagccacgctgtgcagatggtgcagtcggctgccctggacgagatgttccagcaccgt
gagggctgcgtcccacgctaccacaaggccctgctgctcctggaggggctgcagcacatg
ctctcggaccaggccgacatcgagaacgtcaccaagtgcaagctgtgcattgagcggaga
ctctcggcgctgctgactggcatctgtgcctga

DBGET integrated database retrieval system