KEGG   Homo sapiens (human): 8411Help
Entry
8411              CDS       T01001                                 

Gene name
EEA1, MST105, MSTP105, ZFYVE2
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8411 (EEA1)
   04145 Phagosome
    8411 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    8411 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q22
AA seq 1411 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSL
HRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLS
LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEI
VSSTRLDLQKKSEALESIKQKLTKQEEEKQILKQDFETLSQETKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQ
LQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGN
INELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNN
YEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQEL
KTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEI
TKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaggattttacagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcctataaacacagtggacgtcaataatgaaagctcttcagagggt
ttcatatgtccccagtgtatgaaatctcttggatctgctgatgaacttttcaaacattat
gaagctgttcatgatgctggtaatgactcaggtcatggaggagagtctaatcttgctttg
aagcgagatgatgtaacactgctcagacaagaggtccaagacctacaggcttcacttaag
gaagaaaaatggtactcggaagaattaaagaaggaattagaaaaatatcaagggctgcag
cagcaagaggccaaacctgatgggttggtgactgattcatcagcagaactacagtctttg
gaacagcaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagactta
tttgaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaagtatgat
gaagaaaggagtcttcgagaagctgctgaacaaaaagtgacacgtctgacagaagaatta
aacaaagaggcaactgtaattcaagatctgaagacggaactgcttcagagacctggtata
gaagatgttgccgtgctaaagaaagaactggtccaagttcaaacactaatggataacatg
accttggaacgtgagcgagaatctgaaaaactcaaagatgaatgcaaaaaattgcagtca
caatatgctagctcagaggccacaataagccagctaaggagtgaacttgccaaaggcccc
caggaagttgctgtatatgtacaggaactacaaaaactgaaaagttcagttaatgaatta
acacaaaaaaatcagaccttgacagaaaacttgctgaaaaaagaacaagactatactaag
ttagaggagaaacataatgaagaatctgtgagtaaaaagaatattcaggcaacccttcat
caaaaagacctagattgtcaacagcttcagtcaagattgtctgcatctgaaacctcactg
catagaatacatgtagaactaagtgaaaaaggagaagctactcaaaagctcaaagaagaa
ttatctgaggtagagaccaagtaccagcatctaaaggcggagtttaagcagctacaacaa
cagagagaagaaaaggagcagcatgggttacaactccaaagtgaaattaatcaattacat
agcaaacttctggagacagagcgccaactaggggaagctcatggtaggctgaaggaacag
agacagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatttacaactc
aaactttctcggttagaagagcagttgaaggaaaaagttacaaattctacagaattgcag
catcaattagataaaacaaagcaacagcatcaagaacaacaggctcttcagcaaagcacc
acggcaaaacttcgagaagctcagaatgatttggaacaagttctacgtcaaattggcgat
aaggaccaaaagatccagaaccttgaagctttattacagaagagtaaagaaaatatttca
ttactagaaaaagaaagagaagatctttatgcaaaaattcaggctggtgaaggagagact
gctgttcttaaccagttacaagaaaaaaaccatacactacaggagcaagtaactcaacta
acagagaagctgaagaatcagtcagaaagtcataaacaagcccaggagaatttgcatgac
caggtacaagagcagaaggcacatcttagagctgcacaagaccgtgtcctttccctagaa
actagtgtcaatgaattaaatagtcaattaaatgaaagcaaggagaaggtctcccagctt
gacatacagattaaagccaaaaccgaactattactatcagcagaagcagcaaaaactgct
caaagagctgatcttcagaatcatttggacacagctcaaaatgcattacaagataaacag
caggagttaaataagattactactcagttggatcaggtcactgcaaagttacaagacaag
caagaacattgcagtcagctggaaagtcatcttaaagaatataaagagaaatacctctct
ttagaacagaaaaccgaagagctagaaggtcaaattaagaaactagaagctgatagtctt
gaagttaaagcaagcaaggagcaggctttgcaagatctacaacagcaaagacagctgaac
acagatttagagctcagagccacagaattgagtaaacaacttgaaatggagaaggaaata
gtatccagtacaagattggatctacagaaaaaatctgaagcccttgaaagtatcaagcaa
aagcttaccaagcaagaggaagaaaaacaaatcctgaaacaagattttgaaactttaagt
caagaaacaaagattcagcatgaggaattgaataacagaattcaaacaacagtaacagaa
ctacaaaaagtgaaaatggagaaagaagctttaatgacagagctttctacagtaaaggac
aaactatcaaaagtttctgattctttgaaaaactctaaaagtgaatttgaaaaggagaat
cagaaaggaaaagccgctatattagacttggaaaaaacttgcaaagaattaaagcatcaa
cttcaagtgcagatggaaaacacacttaaggaacagaaggaactgaaaaagtcacttgaa
aaagagaaggaggcttctcatcagttgaaattggaactcaattcaatgcaggaacaactt
atacaggcccagaatactttaaaacaaaatgaaaaagaagagcaacaacttcaggggaac
ataaatgagctaaagcaatcaagtgaacagaagaaaaaacaaattgaagcactccaagga
gagcttaaaattgctgttttacagaagacagagcttgagaataaactacagcagcagtta
acacaggcagcccaggaacttgcagcagagaaagagaaaatatcagtattacaaaacaac
tatgaaaaaagtcaggaaactttcaaacagcttcaatctgatttctatgggagggaatct
gaacttctagccaccaggcaagatcttaagtctgtagaagagaagctttctctagcacag
gaggacttgatttcaaacagaaatcaaattggaaatcaaaataaattgattcaagaactg
aagactgccaaggctacattggagcaggattcagcaaagaaagaacagcaattgcaggag
cgatgtaaagcactacaagacattcagaaagaaaagtcactgaaagaaaaagaactggta
aatgagaagtctaaattggcagagatagaagaaattaaatgtagacaagaaaaagaaatc
actaaactaaacgaagaactcaagtcccacaaactagaaagcataaaggagataacaaat
cttaaagatgctaaacagcttctaattcagcagaaattagaacttcaaggaaaagcggac
tccctgaaggcagctgttgaacaggagaagagaaatcagcagatactaaaagaccaggtg
aaaaaggaagaagaggagctgaagaaagaatttattgagaaagaagctaagttgcattcc
gaaataaaagaaaaggaagtaggaatgaagaagcatgaagaaaatgaggctaaacttacc
atgcagattacagcattaaatgaaaacttaggcactgtgaagaaggagtggcaatctagt
caacggagagttagtgagcttgagaaacaaacggatgacttacggggtgaaattgcagta
ttagaagcaacggttcagaataatcaagatgaaaggagagcactactggaaagatgtctt
aaaggagaaggtgaaatagaaaagcttcaaaccaaagtattagaattgcaaagaaagctg
gataatacaactgcagcagtgcaggagctgggcagagaaaaccaatcacttcagatcaaa
catacacaagcgttgaatagaaagtgggccgaagacaatgaagtacaaaactgtatggcc
tgtgggaaaggcttttcagtaacagtgagacggcatcactgccgacagtgtggaaatatc
ttctgtgctgaatgttcagccaaaaatgccttaactccttcctccaagaagcctgttcgt
gtctgtgatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system