KEGG   Homo sapiens (human): 8411Help
Entry
8411              CDS       T01001                                 

Gene name
EEA1, MST105, MSTP105, ZFYVE2
Definition
(RefSeq) early endosome antigen 1
  KO
K12478  early endosome antigen 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8411 (EEA1)
   04145 Phagosome
    8411 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    8411 (EEA1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    8411 (EEA1)
 Protein recycling
   Others
    8411 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE Atg14 IBR zf-C2H2_4 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 8411
NCBI-ProteinID: NP_003557
OMIM: 605070
HGNC: 3185
Ensembl: ENSG00000102189
Vega: OTTHUMG00000170110
Pharos: Q15075(Tbio)
UniProt: Q15075
Structure
PDB: 

Jmol
Position
12q22
AA seq 1411 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSL
HRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLS
LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEI
VSSTRLDLQKKSEALESIKQKLTKQEEEKQILKQDFETLSQETKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQ
LQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGN
INELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNN
YEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQEL
KTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEI
TKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaggattttacagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcctataaacacagtggacgtcaataatgaaagctcttcagagggt
ttcatatgtccccagtgtatgaaatctcttggatctgctgatgaacttttcaaacattat
gaagctgttcatgatgctggtaatgactcaggtcatggaggagagtctaatcttgctttg
aagcgagatgatgtaacactgctcagacaagaggtccaagacctacaggcttcacttaag
gaagaaaaatggtactcggaagaattaaagaaggaattagaaaaatatcaagggctgcag
cagcaagaggccaaacctgatgggttggtgactgattcatcagcagaactacagtctttg
gaacagcaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagactta
tttgaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaagtatgat
gaagaaaggagtcttcgagaagctgctgaacaaaaagtgacacgtctgacagaagaatta
aacaaagaggcaactgtaattcaagatctgaagacggaactgcttcagagacctggtata
gaagatgttgccgtgctaaagaaagaactggtccaagttcaaacactaatggataacatg
accttggaacgtgagcgagaatctgaaaaactcaaagatgaatgcaaaaaattgcagtca
caatatgctagctcagaggccacaataagccagctaaggagtgaacttgccaaaggcccc
caggaagttgctgtatatgtacaggaactacaaaaactgaaaagttcagttaatgaatta
acacaaaaaaatcagaccttgacagaaaacttgctgaaaaaagaacaagactatactaag
ttagaggagaaacataatgaagaatctgtgagtaaaaagaatattcaggcaacccttcat
caaaaagacctagattgtcaacagcttcagtcaagattgtctgcatctgaaacctcactg
catagaatacatgtagaactaagtgaaaaaggagaagctactcaaaagctcaaagaagaa
ttatctgaggtagagaccaagtaccagcatctaaaggcggagtttaagcagctacaacaa
cagagagaagaaaaggagcagcatgggttacaactccaaagtgaaattaatcaattacat
agcaaacttctggagacagagcgccaactaggggaagctcatggtaggctgaaggaacag
agacagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatttacaactc
aaactttctcggttagaagagcagttgaaggaaaaagttacaaattctacagaattgcag
catcaattagataaaacaaagcaacagcatcaagaacaacaggctcttcagcaaagcacc
acggcaaaacttcgagaagctcagaatgatttggaacaagttctacgtcaaattggcgat
aaggaccaaaagatccagaaccttgaagctttattacagaagagtaaagaaaatatttca
ttactagaaaaagaaagagaagatctttatgcaaaaattcaggctggtgaaggagagact
gctgttcttaaccagttacaagaaaaaaaccatacactacaggagcaagtaactcaacta
acagagaagctgaagaatcagtcagaaagtcataaacaagcccaggagaatttgcatgac
caggtacaagagcagaaggcacatcttagagctgcacaagaccgtgtcctttccctagaa
actagtgtcaatgaattaaatagtcaattaaatgaaagcaaggagaaggtctcccagctt
gacatacagattaaagccaaaaccgaactattactatcagcagaagcagcaaaaactgct
caaagagctgatcttcagaatcatttggacacagctcaaaatgcattacaagataaacag
caggagttaaataagattactactcagttggatcaggtcactgcaaagttacaagacaag
caagaacattgcagtcagctggaaagtcatcttaaagaatataaagagaaatacctctct
ttagaacagaaaaccgaagagctagaaggtcaaattaagaaactagaagctgatagtctt
gaagttaaagcaagcaaggagcaggctttgcaagatctacaacagcaaagacagctgaac
acagatttagagctcagagccacagaattgagtaaacaacttgaaatggagaaggaaata
gtatccagtacaagattggatctacagaaaaaatctgaagcccttgaaagtatcaagcaa
aagcttaccaagcaagaggaagaaaaacaaatcctgaaacaagattttgaaactttaagt
caagaaacaaagattcagcatgaggaattgaataacagaattcaaacaacagtaacagaa
ctacaaaaagtgaaaatggagaaagaagctttaatgacagagctttctacagtaaaggac
aaactatcaaaagtttctgattctttgaaaaactctaaaagtgaatttgaaaaggagaat
cagaaaggaaaagccgctatattagacttggaaaaaacttgcaaagaattaaagcatcaa
cttcaagtgcagatggaaaacacacttaaggaacagaaggaactgaaaaagtcacttgaa
aaagagaaggaggcttctcatcagttgaaattggaactcaattcaatgcaggaacaactt
atacaggcccagaatactttaaaacaaaatgaaaaagaagagcaacaacttcaggggaac
ataaatgagctaaagcaatcaagtgaacagaagaaaaaacaaattgaagcactccaagga
gagcttaaaattgctgttttacagaagacagagcttgagaataaactacagcagcagtta
acacaggcagcccaggaacttgcagcagagaaagagaaaatatcagtattacaaaacaac
tatgaaaaaagtcaggaaactttcaaacagcttcaatctgatttctatgggagggaatct
gaacttctagccaccaggcaagatcttaagtctgtagaagagaagctttctctagcacag
gaggacttgatttcaaacagaaatcaaattggaaatcaaaataaattgattcaagaactg
aagactgccaaggctacattggagcaggattcagcaaagaaagaacagcaattgcaggag
cgatgtaaagcactacaagacattcagaaagaaaagtcactgaaagaaaaagaactggta
aatgagaagtctaaattggcagagatagaagaaattaaatgtagacaagaaaaagaaatc
actaaactaaacgaagaactcaagtcccacaaactagaaagcataaaggagataacaaat
cttaaagatgctaaacagcttctaattcagcagaaattagaacttcaaggaaaagcggac
tccctgaaggcagctgttgaacaggagaagagaaatcagcagatactaaaagaccaggtg
aaaaaggaagaagaggagctgaagaaagaatttattgagaaagaagctaagttgcattcc
gaaataaaagaaaaggaagtaggaatgaagaagcatgaagaaaatgaggctaaacttacc
atgcagattacagcattaaatgaaaacttaggcactgtgaagaaggagtggcaatctagt
caacggagagttagtgagcttgagaaacaaacggatgacttacggggtgaaattgcagta
ttagaagcaacggttcagaataatcaagatgaaaggagagcactactggaaagatgtctt
aaaggagaaggtgaaatagaaaagcttcaaaccaaagtattagaattgcaaagaaagctg
gataatacaactgcagcagtgcaggagctgggcagagaaaaccaatcacttcagatcaaa
catacacaagcgttgaatagaaagtgggccgaagacaatgaagtacaaaactgtatggcc
tgtgggaaaggcttttcagtaacagtgagacggcatcactgccgacagtgtggaaatatc
ttctgtgctgaatgttcagccaaaaatgccttaactccttcctccaagaagcctgttcgt
gtctgtgatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system