KEGG   Homo sapiens (human): 84128Help
Entry
84128             CDS       T01001                                 

Gene name
WDR75, NET16, UTP17
Definition
(RefSeq) WD repeat domain 75
  KO
K14552  
NET1-associated nuclear protein 1 (U3 small nucleolar RNA-associated protein 17)
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    84128 (WDR75)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.2
AA seq 766 aa AA seqDB search
MHCEYPKELYSCSLDGTIKLWDYIDGILIKTFIVGCKLHALFTLAQAEDSVFVIVNKEKP
DIFQLVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREFYLSVYFFK
KKTTSRFTLSSSRNKKHAKNNFTCVACHPTEDCIASGHMDGKIRLWRNFYDDKKYTYTCL
HWHHDMVMDLAFSVTGTSLLSGGRESVLVEWRDATEKNKEFLPRLGATIEHISVSPAGDL
FCTSHSDNKIIIIHRNLEASAVIQGLVKDRSIFTGLMIDPRTKALVLNGKPGHLQFYSLQ
SDKQLYNLDIIQQEYINDYGLIQIELTKAAFGCFGNWLATVEQRQEKETELELQMKLWMY
NKKTQGFILNTKINMPHEDCITALCFCNAEKSEQPTLVTASKDGYFKVWILTDDSDIYKK
AVGWTCDFVGSYHKYQATNCCFSEDGSLLAVSFEEIVTIWDSVTWELKCTFCQRAGKIRH
LCFGRLTCSKYLLGATENGILCCWNLLSCALEWNAKLNVRVMEPDPNSENIAAISQSSVG
SDLFVFKPSEPRPLYIQKGISREKVQWGVFVPRDVPESFTSEAYQWLNRSQFYFLTKSQS
LLTFSTKSPEEKLTPTSKQLLAEESLPTTPFYFILGKHRQQQDEKLNETLENELVQLPLT
ENIPAISELLHTPAHVLPSAAFLCSMFVNSLLLSKETKSAKEIPEDVDMEEEKESEDSDE
ENDFTEKVQDTSNTGLGEDIIHQLSKSEEKELRKFRKIDYSWIAAL
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcgaatatccaaaagagctgtattcttgttcccttgatggcacaattaaactg
tgggactatatagatggcatcttaataaagactttcatagttggatgtaaacttcatgcc
ctctttactcttgcccaagctgaggattctgtctttgttatagtgaataaagaaaaacca
gatatatttcagctggtttcagtgaaactgccaaaatcctcaagccaggaagtagaagcc
aaggagctgtcctttgttttggattacataaaccagtcacccaagtgcattgcctttgga
aacgagggagtatatgttgctgcagtacgggaattttacttgtctgtttattttttcaaa
aagaaaacaacatcaaggtttactttatcatcatcaagaaataagaagcatgctaaaaac
aattttacatgtgtagcatgtcacccaacggaagactgcatcgcatctggtcacatggat
ggcaaaattcgtctttggaggaatttttatgatgataagaaatatacgtacacatgttta
cattggcaccatgatatggttatggatttggctttttcagtgacaggcaccagtctgctg
agtggcggtcgtgaatctgtacttgtagagtggcgcgatgcaacagagaagaataaggag
tttctcccgcgtttaggagctactattgaacatatctcagtctcgcctgcaggagattta
ttctgcacttctcactctgataataagataataattattcaccgaaaccttgaagcatcc
gcagtaattcaaggcctagtgaaagataggagtatcttcactggtttgatgattgatcca
agaactaaagctttggttttgaatggaaaacctggccacctgcagttttattctctccag
agtgataaacagttatacaatttagatattatacagcaagaatatattaatgattatggt
ctgatccaaattgaactaacaaaggctgcatttggctgctttggtaactggcttgcaaca
gtggaacagcggcaagaaaaggaaactgagcttgaattgcaaatgaaactgtggatgtat
aataagaaaacacaagggtttattcttaacactaaaattaacatgccacacgaagactgc
attacagctctctgtttctgtaatgcagaaaaatctgaacagcccaccttggttacagct
agcaaagatggttacttcaaagtatggatattaacagatgactctgacatatacaaaaaa
gctgttggctggacctgtgactttgttggtagttatcacaagtatcaagcaactaactgt
tgtttctccgaagatggttctttactagcagttagttttgaggaaatagtcacaatatgg
gattctgtaacatgggaacttaaatgtacattttgccaacgagctgggaaaataaggcac
ctttgctttgggagattgacgtgttcaaagtatctacttggtgctactgaaaatggcatt
ctttgctgttggaatctgctgagctgtgcattggagtggaatgcaaaattaaatgttaga
gttatggaacccgatcctaattcagagaatattgctgcaatctctcagtcttcagtgggt
tcagacttgtttgtatttaaacctagtgagccaaggccattgtatattcaaaagggtatc
tccagagagaaagtccagtggggagtgtttgttccacgagatgtccctgaatccttcacc
tcagaagcttaccagtggctaaatagatcccagttttacttcctaacaaaatcacagagt
ttattgacattcagtacaaagtctccagaagaaaaactcacaccaacaagcaaacagctg
ctagcagaagaaagtcttcccacaaccccattttatttcatattgggaaaacacaggcaa
cagcaggatgaaaaactaaacgaaactttagagaatgagctggtacaactacccttaaca
gaaaacatacccgcaattagtgagcttcttcacactccagcccatgtcctgccatctgct
gctttcctgtgctccatgtttgtaaattcattgctgctgtctaaagagactaagagtgct
aaggaaattcctgaagatgtagatatggaagaagaaaaagaaagtgaagattcagatgaa
gaaaatgattttaccgaaaaagtccaggatacaagtaacacaggtttaggagaagacatt
atacatcagttgtcaaaatctgaagaaaaagaactgagaaaatttaggaaaatagactac
agctggatagctgccctttaa

DBGET integrated database retrieval system