KEGG   Homo sapiens (human): 84132Help
Entry
84132             CDS       T01001                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42 (EC:3.4.19.12)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     84132 (USP42)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   84132 (USP42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7p22.1
AA seq 1316 aa AA seqDB search
MTIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIVYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHPTHSPGQSSPRPVISQRVVTNKQAAPGFIGPQLPSHMIKNPPHLNGTGPLKDTPSSS
MSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPN
LHSNSLENPTKPVPSSTITNSAVQSTSNASTMSVSSKVTKPIPRSESCSQPVMNGKSKLN
SSVLVPYGAESSEDSDEESKGLGKENGIGTIVSSHSPGQDAEDEEATPHELQEPMTLNGA
NSADSDSDPKENGLAPDGASCQGQPALHSENPFAKANGLPGKLMPAPLLSLPEDKILETF
RLSNKLKGSTDEMSAPGAERGPPEDRDAEPQPGSPAAESLEEPDAAAGLSSTKKAPPPRD
PGTPATKEGAWEAMAVAPEEPPPSAGEDIVGDTAPPDLCDPGSLTGDASPLSQDAKGMIA
EGPRDSALAEAPEGLSPAPPARSEEPCEQPLLVHPSGDHARDAQDPSQSLGAPEAAERPP
APVLDMAPAGHPEGDAEPSPGERVEDAAAPKAPGPSPAKEKIGSLRKVDRGHYRSRRERS
SSGEPARESRSKTEGHRHRRRRTCPRERDRQDRHAPEHHPGHGDRLSPGERRSLGRCSHH
HSRHRSGVELDWVRHHYTEGERGWGREKFYPDRPRWDRCRYYHDRYALYAARDWKPFHGG
REHERAGLHERPHKDHNRGRRGCEPARERERHRPSSPRAGAPHALAPHPDRFSHDRTALV
AGDNCNLSDRFHEHENGKSRKRRHDSVENSDSHVEKKARRSEQKDPLEEPKAKKHKKSKK
KKKSKDKHRDRDSRHQQDSDLSAACSDADLHRHKKKKKKKKRHSRKSEDFVKDSELHLPR
VTSLETVAQFRRAQGGFPLSGGPPLEGVGPFREKTKHLRMESRDDRCRLFEYGQGD
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaagcttctgaatcttcagacccatcagcctatcagaatcagcct
ggcagctccgaggcagtctcacctggagacatggatgcaggttctgccagctggggtgct
gtgtcttcattgaatgatgtgtcaaatcacacactttctttaggaccagtacctggtgct
gtagtttattcgagttcatctgtacctgataaatcaaaaccatcaccacaaaaggatcaa
gccctaggtgatggcatcgctcctccacagaaagttcttttcccatctgagaagatttgt
cttaagtggcaacaaactcatagagttggagctgggctccagaatttgggcaatacctgt
tttgccaatgcagcactgcagtgtttaacctacacaccacctcttgccaattacatgcta
tcacatgaacactccaaaacatgtcatgcagaaggcttttgtatgatgtgtacaatgcaa
gcacatattacccaggcactcagtaatcctggggacgttattaaaccaatgtttgtcatc
aatgagatgcggcgtatagctaggcacttccgttttggaaaccaagaagatgcccatgaa
ttccttcaatacactgttgatgctatgcagaaagcatgcttgaatggcagcaataaatta
gacagacacacccaggccaccactcttgtttgtcagatatttggaggatacctaagatct
agagtcaaatgtttaaattgcaagggcgtttcagatacttttgatccatatcttgatata
acattggagataaaggctgctcagagtgtcaacaaggcattggagcagtttgtgaagccg
gaacagcttgatggagaaaactcgtacaagtgcagcaagtgtaaaaagatggttccagct
tcaaagaggttcactatccatagatcctctaatgttcttacactttctctgaaacgtttt
gcaaattttaccggtggaaaaattgctaaggatgtgaaataccctgagtatcttgatatt
cggccatatatgtctcaacccaacggagagccaattgtctacgtcttgtatgcagtgctg
gtccacactggttttaattgccatgctggccattacttctgctacataaaagctagcaat
ggcctctggtatcaaatgaatgactccattgtatctaccagtgatattagatcggtactc
agccaacaagcctatgtgctcttttatatcaggtcccatgatgtgaaaaatggaggtgaa
cttactcatcccacccatagccccggccagtcctctccccgccccgtcatcagtcagcgg
gttgtcaccaacaaacaggctgcgccaggctttatcggaccacagcttccctctcacatg
ataaagaatccacctcacttaaatgggactggaccattgaaagacacgccaagcagttcc
atgtcgagtcctaacgggaattccagtgtcaacagggctagtcctgttaatgcttcagct
tctgtccaaaactggtcagttaataggtcctcagtgatcccagaacatcctaagaaacaa
aaaattacaatcagtattcacaacaagttgcctgttcgccagtgtcagtctcaacctaac
cttcatagtaattctttggagaaccctaccaagcccgttccctcttctaccattaccaat
tctgcagtacagtctacctcgaacgcatctacgatgtcagtttctagtaaagtaacaaaa
ccgatcccccgcagtgaatcctgctcccagcccgtgatgaatggcaaatccaagctgaac
tccagcgtgctggtgccctatggcgccgagtcctctgaggactctgacgaggagtcaaag
gggctgggcaaggagaatgggattggtacgattgtgagctcccactctcccggccaagat
gccgaagatgaggaggccactccgcacgagcttcaagaacccatgaccctaaacggtgct
aatagtgcagacagcgacagtgacccgaaagaaaacggcctagcgcctgatggtgccagc
tgccaaggccagcctgccctgcactcagaaaatccctttgctaaggcaaacggtcttcct
ggaaagttgatgcctgctcctttgctgtctctcccagaagacaaaatcttagagaccttc
aggcttagcaacaaactgaaaggctcgacggatgaaatgagtgcacctggagcagagagg
ggccctcccgaggaccgcgacgccgagcctcagcctggcagccccgccgccgaatccctg
gaggagccagatgcggccgccggcctcagcagcaccaagaaggctccgccgccccgcgat
cccggcacccccgctaccaaagaaggcgcctgggaggccatggccgtcgcccccgaggag
cctccgcccagcgccggcgaggacatcgtgggggacacagcaccccctgacctgtgtgat
cccgggagcttaacaggcgatgcgagcccgttgtcccaggacgcaaaggggatgatcgcg
gagggcccgcgggactcggcgttggcggaagccccggaagggttgagtccggctccgcct
gcgcggtcggaggagccctgcgagcagccactccttgttcaccccagcggggaccacgcc
cgggacgctcaggacccatcccagagcttgggcgcacccgaggccgcagagcggccgcca
gctcctgtgctggacatggccccggccggtcacccggaaggggacgctgagcctagcccc
ggcgagagggtcgaggacgccgcggcgccgaaagccccaggcccttccccagcgaaggag
aaaatcggcagcctcagaaaggtggaccgaggccactaccgcagccggagagagcgctcg
tccagcggggagcccgccagagagagcaggagcaagactgagggccaccgtcaccggcgg
cgccgcacctgcccccgggagcgcgaccgccaggaccgccacgccccggagcaccacccc
ggccacggcgacaggctcagccctggcgagcgccgctctctgggcaggtgcagtcaccac
cactcccgacaccggagcggggtggagctggactgggtcagacaccactacaccgagggc
gagcgtggctggggccgggagaagttctaccccgacaggccgcgctgggacaggtgccgg
tactaccatgacaggtacgccctgtacgctgcccgggactggaagcccttccacggcggc
cgcgagcacgagcgggccgggctgcacgagcggccgcacaaggaccacaaccggggccgt
aggggctgcgagccggcccgggagagggagcggcaccgccccagcagcccccgcgcaggc
gcgccccacgccctcgccccgcaccccgaccgcttctcccacgacagaactgcacttgta
gccggagacaactgtaacctctctgatcggtttcacgaacacgaaaatggaaagtcccgg
aaacggagacacgacagtgtggagaacagtgacagtcatgttgaaaagaaagcccggagg
agcgaacagaaggatcctctagaagagcctaaagcaaagaagcacaaaaaatcaaagaag
aaaaagaaatccaaagacaaacaccgagaccgcgactccaggcatcagcaggactcagac
ctctcagcagcgtgctctgacgctgacctccacagacacaaaaaaaagaagaagaaaaag
aagagacattcaagaaaatcagaggactttgttaaagattcagaactgcacttacccagg
gtcaccagcttggagactgtcgcccagttccggagagcccagggtggctttcctctctct
ggtggcccgcctctggaaggcgtcggacctttccgtgagaaaacgaaacacttacggatg
gaaagcagggatgacaggtgtcgtctctttgagtatggccagggtgattga

DBGET integrated database retrieval system