KEGG   Homo sapiens (human): 84134Help
Entry
84134             CDS       T01001                                 

Gene name
TOMM40L, TOMM40B
Definition
translocase of outer mitochondrial membrane 40 homolog (yeast)-like
Orthology
K11518  
mitochondrial import receptor subunit TOM40
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    84134 (TOMM40L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    84134 (TOMM40L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.3
AA seq 274 aa AA seqDB search
MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHF
QVAHTIHMSALGLPGYHLHAAYAGDWQLSPTETQQAKFLTWQFDGEYRGDDYTATLTLGN
PDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGS
GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAV
LEKKMPPLPVTLALGAFLNHWRNRFHCGFSITVG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacattgggcctggcaccaatggggactttgccccgccggagcccccgccga
gaggaacccctgcccaaccctgggagcttcgatgagctgcaccgtctatgcaaagatgta
ttcccagcacagatggagggagtgaagctcgttgtcaacaaggttctgagcagccatttc
caggtggcgcacactatacacatgagtgccctgggcttgccgggatatcacctccatgcg
gcctatgcaggggattggcagctcagtcccactgagacgcagcaggccaagttcctgaca
tggcagtttgatggcgagtatcggggagatgactacacagccactctgaccctaggaaat
cctgacctgattggggagtcggtgatcatggttgctcacttcctgcagagcctcactcat
cggctggtgctgggaggagagctagtttatcaccggcggccaggcgaagagggggccatc
ttgacactggctgggaagtactcggctgtacactgggtagctacattgaatgtgggatca
ggcggggcccatgcaagttactaccacagggcaaatgaacaggttcaggttggagtggag
tttgaggcaaacacaaggctacaagacacaacattctcctttggttaccacctgactctg
ccccaggccaacatggtatttagaggcttggtggatagtaactggtgtgtaggtgctgtg
ctggagaagaagatgccccctctgcctgtcaccctagcccttggagccttcctcaatcac
tggcgcaacagattccattgtggcttcagcatcactgtgggctga

DBGET integrated database retrieval system