KEGG   Homo sapiens (human): 84134Help
Entry
84134             CDS       T01001                                 

Gene name
TOMM40L, TOMM40B
Definition
(RefSeq) translocase of outer mitochondrial membrane 40 like
  KO
K11518  
mitochondrial import receptor subunit TOM40
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    84134 (TOMM40L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    84134 (TOMM40L)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   84134 (TOMM40L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.3
AA seq 308 aa AA seqDB search
MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHF
QVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLR
AKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGG
ELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTR
LQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFH
CGFSITVG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacattgggcctggcaccaatggggactttgccccgccggagcccccgccga
gaggaacccctgcccaaccctgggagcttcgatgagctgcaccgtctatgcaaagatgta
ttcccagcacagatggagggagtgaagctcgttgtcaacaaggttctgagcagccatttc
caggtggcgcacactatacacatgagtgccctgggcttgccgggatatcacctccatgcg
gcctatgcaggggattggcagctcagtcccactgaggtgttccccactgtggtaggggat
atggacagcagtggcagcctgaacgcccaggtcttgctcctcttggcagagcggctccga
gctaaggctgtcttccagacgcagcaggccaagttcctgacatggcagtttgatggcgag
tatcggggagatgactacacagccactctgaccctaggaaatcctgacctgattggggag
tcggtgatcatggttgctcacttcctgcagagcctcactcatcggctggtgctgggagga
gagctagtttatcaccggcggccaggcgaagagggggccatcttgacactggctgggaag
tactcggctgtacactgggtagctacattgaatgtgggatcaggcggggcccatgcaagt
tactaccacagggcaaatgaacaggttcaggttggagtggagtttgaggcaaacacaagg
ctacaagacacaacattctcctttggttaccacctgactctgccccaggccaacatggta
tttagaggcttggtggatagtaactggtgtgtaggtgctgtgctggagaagaagatgccc
cctctgcctgtcaccctagcccttggagccttcctcaatcactggcgcaacagattccat
tgtggcttcagcatcactgtgggctga

DBGET integrated database retrieval system