KEGG   Homo sapiens (human): 84135Help
Entry
84135             CDS       T01001                                 

Gene name
UTP15, NET21
Definition
(RefSeq) UTP15, small subunit processome component
  KO
K14549  
U3 small nucleolar RNA-associated protein 15
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    84135 (UTP15)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    84135 (UTP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8TED0(Tdark)
UniProt: 
Position
5q13.2
AA seq 518 aa AA seqDB search
MAGYKPVAIQTYPILGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASS
RIHIYGRYSQEPIKTFSRFKDTAYCATFRQDGRLLVAGSEDGGVQLFDISGRAPLRQFEG
HTKAVHTVDFTADKYHVVSGADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNPDLF
ITGSYDHTVKMFDARTSESVLSVEHGQPVESVLLFPSGGLLVSAGGRYVKVWDMLKGGQL
LVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSYKVVHSFDYAASILSLALAHE
DETIVVGMTNGILSVKHRKSEAKKESLPRRRRPAYRTFIKGKNYMKQRDDILINRPAKKH
LELYDRDLKHFRISKALDRVLDPTCTIKTPEITVSIIKELNRRGVLANALAGRDEKEISH
VLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLLLQGLVEKEIDYQREL
LETLGMMDMLFATMRRKEGTSVLEHTSDGFPENKKIES
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctggttataagcctgtagctattcagacatatcctatacttggtgaaaaaatcacc
caagatacactgtactggaacaactataagacccctgttcagattaaggaatttggtgca
gtttcaaaagtagacttttctcctcagcctccatataattatgctgtcacagcttcctca
agaattcacatttatggccgatactcccaagaacctataaaaaccttttctcgatttaaa
gacacagcatactgtgctacttttcgacaagatggtagattgcttgtggctggcagtgaa
gatggtggagttcaactttttgatataagtgggagggctcccctcaggcagtttgaaggc
catacaaaagcagttcatacagtagattttacagctgacaaatatcacgtggtctctggg
gctgatgattatacagttaaattatgggatattccaaactccaaagaaattttgacattt
aaagaacactctgattatgtgaggtgtggatgtgctagcaaacttaatccggatctcttt
ataacaggatcatatgatcatactgtgaagatgtttgatgcacgaacgagtgagagtgtt
ctctccgttgagcatgggcagccagtggagagtgtcctacttttcccctctggaggtctt
ctggtgtcagcaggaggtcgttatgttaaagtctgggacatgttaaaaggaggacaattg
ctagtatctttgaaaaatcatcacaaaaccgtgacatgtttatgtctaagcagctctgga
cagaggttactctctggctcactggataggaaggtgaaagtatacagcacaacttcctac
aaagtagtccacagttttgattatgcagcttcaattttgagtcttgcccttgcacatgaa
gatgagacaatagttgtaggaatgaccaatggaatactgagtgttaaacatcggaaatct
gaagcaaagaaggaatcacttcccagaagaagaaggcctgcatatcgaacctttattaaa
ggaaaaaattacatgaagcaacgggatgacattttgattaacaggccagcaaagaagcac
ctagaattgtatgacagggatctgaaacattttcggatctctaaggcactcgatagagtt
cttgatcccacttgtacaataaagacacccgagattacggtgtccatcataaaggagtta
aatcgaagaggagtccttgcaaatgcgcttgcaggtcgggatgagaaggaaatcagtcat
gttcttaattttttgataaggaatctttctcagccaagatttgcccctgttttaatcaat
gctgctgaaataattattgatatatatctgcctgtaattggtcagtcccctgtagttgat
aaaaagtttttactacttcaaggacttgtagaaaaagagattgattaccaaagagaattg
ttagaaaccttggggatgatggatatgctttttgccaccatgagaaggaaggaaggcact
tctgtgttggaacacacatctgatggatttccagagaataagaagatagaatcatag

DBGET integrated database retrieval system