KEGG   Homo sapiens (human): 84148Help
Entry
84148             CDS       T01001                                 

Gene name
KAT8, MOF, MYST1, ZC2HC8, hMOF
Definition
K(lysine) acetyltransferase 8 (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcggcggggacttcaggggtcgcgggggag
ggcgagcccgggcccggggagaatgcggccgctgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcgaccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactacgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtacag
aagaactcagagaagtacctgagcgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaagacttatgcagagatggac
cccaccacagcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaattgatgcctggtatttctcaccattccccgaagac
tatgggaaacagcccaagctctggctctgcgagtactgcctcaagtacatgaaatatgag
aagagctaccgcttccacttgggtcagtgccagtggcggcagccccccgggaaagagatc
taccgcaagagcaacatctccgtgtacgaagttgatggcaaagaccataagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccataagacactgtactttgacgtg
gagccgttcgtcttttacatcctgactgaggtggaccggcagggggcccacattgttggc
tacttctccaaggagaaggagtccccggatggaaacaatgtggcctgcatcctgaccttg
cccccctaccaacgccgcggctacgggaagttcctcatcgctttcagttatgagctctcc
aagctggagagcacagtcggctccccggagaagccactgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtgctgctagagatcctgcgggacttccggggcacactg
tccatcaaggacctcagccagatgaccagtatcacccaaaatgacatcatcagtaccctg
caatccctcaatatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggagcacctcaaaagtgcccagtataagaaaccacccatcacagtggactcc
gtctgcctcaagtgggcaccccccaagcacaagcaagtcaagctctccaagaagtga

DBGET integrated database retrieval system